(data stored in ACNUC30630 zone)

EMBL: BX251410.PE51

BX251410.PE51        Location/Qualifiers
FT   CDS_pept        complement(46318..47001)
FT                   /transl_table=11
FT                   /locus_tag="TW055"
FT                   /product="putative two component system response regulator"
FT                   /note="Similar to Streptomyces coelicolor putative two
FT                   component system response regulator SCO4020 or 2SC10A7.24
FT                   SWALL:Q9ADN7 (EMBL:AL583945) (271 aa) fasta scores: E():
FT                   1.2e-40, 50.44% id in 226 aa"
FT                   /protein_id="CAD66743.1"
FT                   /translation="MSQTKILVVDDEANIRDLLAASLRFAGYGVVTAGNGAGAVSAVLA
FT                   EEPDLIIMDVMLPDMSGFAATKRLREAGFRCPVIFLSARDSTEDKITGLTVGGDDYVTK
FT                   PFSLDEILARVAAILRRTKIDDVDATIRVGDLVIDQNSNEVFLKGNLIDLSPTEFKLLR
FT                   YFMLNPNRVLSKSQILGHVWDYDFDGDSSIVESYISYIRRKLAAYSSETIIHTKRGFGY
FT                   IMRTR"
     atgagtcaga caaagattct agttgttgac gacgaagcca atatacggga tctcctggcg        60
     gcgagcttgc ggttcgcggg gtacggtgtg gtcaccgctg ggaatggcgc cggtgcagtc       120
     tcggcggtcc tggctgagga gccagacctg ataatcatgg atgttatgct cccagatatg       180
     agcgggtttg ctgcaacgaa acgacttcgc gaggctggtt ttcgctgtcc cgtgatattc       240
     ctgagtgcaa gagatagcac agaagacaag ataactggcc tcaccgtagg tggtgatgat       300
     tacgttacaa aaccatttag tctcgatgag atactggcgc gtgtggcagc tattctgcgt       360
     cgaacaaaga tagatgatgt agacgcaact atccgtgttg gtgacctagt aatcgatcaa       420
     aactcaaatg aggtgttcct aaagggtaac ctaattgatc tcagtccaac tgagttcaaa       480
     cttctgcggt actttatgtt gaatccaaac cgcgtgcttt caaagtctca aatactgggg       540
     cacgtttggg actatgattt tgatggtgac tcgagtattg tcgagtccta tatttcgtat       600
     ataagacgca agttagcagc ttacagtagc gaaacgatta ttcataccaa gcgaggtttt       660
     ggttatatca tgagaacgcg ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page