(data stored in ACNUC30630 zone)

EMBL: BX251410.PE52

BX251410.PE52        Location/Qualifiers
FT   CDS_pept        47266..47643
FT                   /transl_table=11
FT                   /locus_tag="TW057"
FT                   /product="cold shock protein B"
FT                   /note="Similar to Streptomyces coelicolor cold shock
FT                   protein B CspB or SCO4325 or SCD12A.08 SWALL:Q9KXN2
FT                   (EMBL:AL357524) (127 aa) fasta scores: E(): 8.1e-16, 42.06%
FT                   id in 126 aa, and to Pseudomonas fragi cold shock protein
FT                   CapB SWALL:CAPB_PSEFR (SWALL:P80415) (69 aa) fasta scores:
FT                   E(): 0.0014, 38.09% id in 63 aa"
FT                   /protein_id="CAD66744.1"
FT                   /translation="MPLGTVRFYNKERGFGFVVSDDGESVFLPAKALPDGVSDLSPGTR
FT                   VDYGAALGKKGSQVLSLRVLRKPPRRGVRSTDDMAVIIEDLMKILDEAGESFKRGRYPK
FT                   AERAKVLAAMLRQVADGLDAN"
     atgcctttgg ggacggttcg tttttataac aaagaacgtg gctttgggtt tgttgtgtcc        60
     gacgatggcg agtctgtttt tttgccggct aaagctttac cggatggcgt ctccgacctt       120
     tcgcccggca cccgtgttga ttacggggca gctctgggaa agaagggctc tcaggtctta       180
     tctctaagag ttctaagaaa accaccccgc cgtggtgtta ggtcaactga tgacatggca       240
     gttataatcg aggatctaat gaaaattctt gatgaagcgg gcgaaagttt taagcgtggc       300
     cgttacccaa aagccgaacg cgctaaggtt cttgcggcta tgctccgcca ggttgcagac       360
     ggtcttgatg ctaactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page