(data stored in ACNUC30630 zone)

EMBL: BX251410.PE53

BX251410.PE53        Location/Qualifiers
FT   CDS_pept        47741..47968
FT                   /transl_table=11
FT                   /locus_tag="TW058"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66745.1"
FT                   /translation="MRYVNLTCGYTGWFWIAAVNKTADGDLNVLELYPSPGPGALAFTA
FT                   RSDQIATGGEYDDDESGDLITPVDRDGLDF"
     atgcgttatg ttaatttgac atgtggatac acgggttggt tttggattgc tgcggttaac        60
     aagaccgctg atggtgatct gaatgttcta gagctatacc cctccccagg cccgggggcg       120
     cttgcattca ccgcacggtc ggaccaaatt gccacaggtg gggaatacga tgacgatgaa       180
     tccggtgatc ttattactcc ggttgatagg gatggcttgg atttctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page