(data stored in ACNUC30630 zone)

EMBL: BX251410.PE54

BX251410.PE54        Location/Qualifiers
FT   CDS_pept        47971..48753
FT                   /transl_table=11
FT                   /locus_tag="TW059"
FT                   /product="putative sporulation/chromosome partition
FT                   protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   partitioning or sporulation protein SCO1772 or SCI51.12c
FT                   SWALL:Q9S228 (EMBL:AL109848) (340 aa) fasta scores: E():
FT                   9.9e-52, 57.14% id in 252 aa, and to Bacillus subtilis
FT                   sporulation initiation inhibitor protein Soj
FT                   SWALL:SOJ_BACSU (SWALL:P37522) (253 aa) fasta scores: E():
FT                   2.6e-38, 46.21% id in 251 aa"
FT                   /protein_id="CAD66746.1"
FT                   /translation="MTKKSARTVAVCNQKGGVGKTTTTINLAACLAERGMRVLTVDLDP
FT                   QGALTAGFGISNFEYTVYDLLLGRNRNAVLIQTSLKGVDVLPANIDLSAAEVYLVSEVA
FT                   REQILAKELESFSSDYDVILIDCQPSLGLLTINALTASHGLLIPLECEYFAMRGLALLL
FT                   ETVRKIQDRLNTALKVDGIIATMFDMRTLHAREVLESVKKAFPGLLLTTVINRTIKFPD
FT                   SSIAGMPVTVFAPNHQASKNYRDLTHELVHRGVFTLPS"
     atgactaaaa aatccgctag gacggttgct gtctgtaacc aaaagggtgg agttggtaaa        60
     acaacaacaa ccataaatct tgctgcatgc ttggccgaac gcggaatgag agttttaacg       120
     gtcgacctag atccacaggg tgccctaact gctggcttcg gaatttccaa ttttgaatac       180
     acggtatacg atcttctgct cggccgtaat cgcaatgctg tattgataca aacctccctc       240
     aaaggcgttg atgtcctgcc agcaaatata gacttgtctg cagctgaagt ctatcttgta       300
     tcggaagttg ccagagagca aatacttgcc aaagagcttg agtcattctc ctccgattat       360
     gatgtgatac taatcgactg ccagccctca ctcggtcttc ttaccataaa tgcacttact       420
     gcaagtcatg gtttacttat tccccttgag tgtgagtatt tcgccatgcg aggattggct       480
     ctattactcg aaacagttcg caaaatccaa gatcgattaa atactgcgct aaaggttgac       540
     ggaattattg caactatgtt cgatatgaga actttgcatg ccagagaggt cttagagagt       600
     gtgaaaaagg cctttcccgg gttactgcta acaactgtta taaataggac aataaaattt       660
     ccagactcca gtatcgctgg catgccggtt accgttttcg ccccaaatca tcaagcatcg       720
     aaaaattatc gcgacctcac gcacgaactt gtacatcgtg gtgtttttac cttaccaagc       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page