(data stored in ACNUC30630 zone)

EMBL: BX251410.PE56

BX251410.PE56        Location/Qualifiers
FT   CDS_pept        49945..52005
FT                   /transl_table=11
FT                   /locus_tag="TW061"
FT                   /product="putative GTP-binding protein"
FT                   /note="Similar to many eg. Streptomyces coelicolor putative
FT                   GTP binding protein SCO1758 or 2SCI34.11c SWALL:Q9EWW8
FT                   (EMBL:AL445403) (492 aa) fasta scores: E(): 8.6e-84, 49.49%
FT                   id in 493 aa. N-terminal region contains match to Pfam
FT                   PF02224 Cytidylate kinase."
FT                   /protein_id="CAD66748.1"
FT                   /translation="MDFTSIVAIDGPAGSGKSSVGRAVAQYLGYGFLPTGSYYRAFAFL
FT                   LDQTKDLDSQLDSFISSVRNDLDPYNSGFNVHIDDSPFFGSSGISASSRNIASELNNPE
FT                   ITSKTAAVARNKSVRVRLNEYFRKLCSESIYPAIVLEGRDATTVIAPNARVKIFLTASL
FT                   VKRAARRSEQLSSEPPNSVLEALRQRDEADNAVTDFLSDDSSRITLDTSDLTFSESVAR
FT                   VLEVIEQAGMPFVSDKWVGENADVLAASGELGATVVIVGRPNVGKSALVNCILGRREAV
FT                   VENRPGVTRDRVVYPAFWAGRPFTLVDTGGWECDAEGLDAEVVAQAEIGMSIADIIIFV
FT                   VDVQHGPVSTDAVIARNLQRQNKPIFLVANKADNASSDSDVAQFWSLGLGQPYACSATH
FT                   GRGVADLMDIVMQSAQVHTPSFCSGAPRVALIGRPNVGKSSLINQLTNSRRAIVDDLAG
FT                   TTRDPLDALAVIGDKSWLFVDTAGLRRKFKSQKGADFYAYLRATTVLRRTEIALLLLDA
FT                   SHAITEQDVRIAEMVVESGRALVIAINKWDLLDEERRYWLEREIDNTFFRFAWAPRVNI
FT                   SARTGRGVKQLATALQTALTNWNTRLNTARVNHFLQRITREQPHPTRGGRRPRILFASQ
FT                   TGVAPPTFTLFTTGFLEPTYRRFLQKSIRSQHSFTGSPIILSVKIRASRNR"
     gtggacttta ctagtatagt tgcaatcgat ggtcctgccg gcagcggaaa aagttctgtt        60
     ggtcgggccg ttgctcaata tttagggtat ggttttctgc caaccggaag ctattaccgt       120
     gcctttgcgt ttctgctaga tcagactaaa gaccttgata gtcagttgga tagcttcatt       180
     tcgtccgtgc gtaatgatct tgatccgtac aatagcgggt ttaacgtgca tattgatgat       240
     agtccgtttt ttgggtcatc aggtatatcc gcatcatcga ggaatattgc ctctgagcta       300
     aacaacccgg aaataacctc aaaaactgcc gctgtggcgc gcaacaaaag tgtacgagtg       360
     cgcctcaacg agtattttag aaagctatgt tctgaaagta tttatccggc cattgtcctt       420
     gaggggcgcg atgcaacaac tgtgatagca ccaaatgcaa gggtgaaaat attcttgaca       480
     gcctcgctgg ttaaacgagc agctcggcgc tccgaacagc tgtcttccga acctccaaat       540
     tccgtactgg aagctttacg tcaaagagat gaggcagaca acgcagtgac tgactttctg       600
     tcagatgaca gctccagaat tactctggac acgagcgatc tgactttctc ggaatcggtt       660
     gcccgagtgc ttgaagtgat tgaacaagct ggaatgccgt ttgtctcaga taaatgggtt       720
     ggagagaatg ccgatgtgct tgcggcttct ggggaacttg gagcaacagt tgtgattgtt       780
     ggccggccaa atgttggaaa atcagccctt gtaaactgca tcctcgggcg cagagaggct       840
     gtagtggaga atcgtccggg cgttacaaga gatcgtgttg tttacccggc attttgggca       900
     ggcagaccat ttactcttgt tgataccggc ggctgggagt gtgatgccga gggccttgat       960
     gctgaggtcg tggctcaggc agaaattggc atgagtattg cggacataat catttttgtg      1020
     gttgatgttc agcatggccc ggttagcact gatgcagtta tcgcccggaa tctacaacga      1080
     cagaataagc caatctttct tgttgcaaat aaagctgata atgccagcag tgactcagat      1140
     gtggcgcaat tttggtctct cggattaggt cagccgtatg cctgtagcgc gacgcatggc      1200
     cggggagttg cagatcttat ggatatagtc atgcagtctg cccaagtcca tacgccaagt      1260
     ttttgttcag gtgcaccacg ggtagcgcta attggccggc caaatgttgg aaaatcgagc      1320
     ttaataaacc aactgacgaa ttcaagaaga gcaattgttg atgatctcgc tgggacgaca      1380
     cgtgatccgc ttgatgcttt ggcggttata ggggataaat catggctctt tgtcgatact      1440
     gcaggtctta gaagaaagtt caaatcacaa aaaggcgcag atttctatgc ttatctccgt      1500
     gcaacaaccg ttttacggcg tactgaaatt gctttattgt tgcttgatgc gagtcacgca      1560
     attactgaac aggatgtgcg tatagcagaa atggttgttg aaagcggccg agccctggta      1620
     attgccataa ataaatggga tttgctggat gaagagcgac gttattggct tgaacgtgaa      1680
     atagataaca cttttttccg ctttgcctgg gcaccccggg tgaatatttc cgcaagaacg      1740
     ggccggggcg taaaacagtt ggccacagcg cttcaaaccg ccttgacaaa ctggaacacg      1800
     cgtctgaaca ctgctcgcgt gaatcatttt ttacaacgca ttacgcgtga gcagccccat      1860
     ccgaccaggg gtggcaggag gccaagaatc ttatttgcca gccagacagg ggttgcccca      1920
     ccgactttta cactgtttac aacaggtttt cttgaaccaa cctaccggcg attcttgcaa      1980
     aagtccatac gctcacaaca cagctttaca ggatccccaa ttattctgag tgtgaaaatt      2040
     cgagcaagtc ggaaccgcta g                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page