(data stored in ACNUC30630 zone)

EMBL: BX251410.PE57

BX251410.PE57        Location/Qualifiers
FT   CDS_pept        complement(52002..53279)
FT                   /transl_table=11
FT                   /locus_tag="TW062"
FT                   /product="putative chorismate binding enzyme"
FT                   /note="Similar to Pseudomonas putida anthranilate synthase
FT                   component I TrpE SWALL:TRPE_PSEPU (SWALL:P20579) (493 aa)
FT                   fasta scores: E(): 5e-16, 29.18% id in 281 aa"
FT                   /protein_id="CAD66749.1"
FT                   /translation="MLPIEVEITRIGNMDRSDFKRQYIRKVLSWDFVYCTHSTMMRTQG
FT                   RVLKINLDSYSAEARFEAAESLINEIHTKIQYTSENLNPIGLIVLFGFTFSPYSARPSF
FT                   LAIPEQMFFWSDGVAWKIDATICHNLSEPSRIFKWPKSISFKMGDFRQEDYKHAITNVV
FT                   NKLLNADISKVVLARDIIAEIHDDFDPEAHAIDLDEAIQRLMNTANGTVFVFDGLFGAS
FT                   PEVLLRTDGNSGFEVSILAGSMSANHPKHVIHNCAASPPYKALDETYLDEKLRLEHSFA
FT                   LNPTLERLSTLMNTAPTVNSYKIRRFTHITHVASFISGTFKPNISPLRALSHIHPTGAI
FT                   AGEPRERALEIIKEIEPFDRELYGGAIGWIGQDSSCEFTLPIRCAQLNRGHIKAFAGCG
FT                   IVKSSIPQKELEESTLKFKTIIDAIS"
     atgcttccaa ttgaagttga aataacaaga attggaaata tggatcgtag cgacttcaag        60
     cgacagtata ttcgcaaagt attgtcttgg gatttcgtat attgtacaca cagcacgatg       120
     atgagaacac agggccgcgt gctaaaaata aatctcgatt cctattccgc cgaggctaga       180
     tttgaggcag ccgagtcgct gataaatgaa atacatacaa agatacagta cacgagcgaa       240
     aatctcaatc cgattggcct tatcgtgcta ttcggattta cattttcgcc atattctgcc       300
     aggccgagtt ttcttgcaat accagagcaa atgttttttt ggagcgacgg ggttgcctgg       360
     aaaatagatg caacgatttg tcataacctc tcggagccct ctcgaatttt caaatggcca       420
     aagagtatta gctttaaaat gggagatttt agacaagagg attataaaca tgccattacc       480
     aatgtggtaa acaaactttt aaatgcagat atatcaaagg tagttttggc gcgggacatt       540
     atcgcagaaa tacatgatga ttttgaccct gaagcacacg caatcgacct tgatgaggcg       600
     atacagagac ttatgaatac ggcaaacggc acggtgtttg tatttgatgg actattcggc       660
     gcttcacccg aggtgctgct gagaacagat ggtaactctg gttttgaggt ctccattctt       720
     gcaggcagca tgtctgccaa tcaccccaaa catgtaatac ataattgtgc ggcaagcccc       780
     ccttacaagg ctctcgatga gacatatctc gatgaaaagc taaggcttga acattccttt       840
     gcgcttaacc caaccttgga gcgacttagc acactcatga acacagcgcc aacggtgaat       900
     tcctacaaaa tcaggagatt tacacacata acccatgtag cgagctttat atccggcaca       960
     tttaagccaa atatctcccc cttgcgcgca ttgagtcata ttcatccaac aggagcaatt      1020
     gctggagagc ccagagaaag agcgctggaa ataatcaaag agatagagcc atttgaccgc      1080
     gagctatacg gcggggcaat agggtggatt gggcaagata gctcatgtga gttcacatta      1140
     cccattcgat gtgcgcagct aaacaggggg catataaaag cttttgccgg gtgtggaata      1200
     gtgaagtcaa gcatcccgca aaaagaactt gaagaaagca cattaaagtt caaaacaatt      1260
     attgacgcaa tatcctag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page