(data stored in ACNUC30630 zone)

EMBL: BX251410.PE58

BX251410.PE58        Location/Qualifiers
FT   CDS_pept        53375..54094
FT                   /transl_table=11
FT                   /locus_tag="TW063"
FT                   /product="putative ubiquinone/menaquinone
FT                   methyltransferase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ubiquinone/menaquinone methyltransferase SCO4556 or
FT                   SCD16a.27c SWALL:Q9XAP8 (EMBL:AL078618) (231 aa) fasta
FT                   scores: E(): 1.6e-29, 42.17% id in 230 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7
FT                   ubiquinone/menaquinone biosynthesis methyltransferase UbiE
FT                   or b3833 or z5355 or ecs4763 SWALL:UBIE_ECOLI
FT                   (SWALL:P27851) (251 aa) fasta scores: E(): 6.5e-23, 36.32%
FT                   id in 245 aa"
FT                   /db_xref="GOA:P67065"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67065"
FT                   /protein_id="CAD66750.1"
FT                   /translation="MGTNIHIDMVIHGKHTAEIRKMFNRVAQAYDRTNLVLSFLQDAHW
FT                   RRAACKMLGVTAGEEVLDVGAGTGASTRTVARTGAAVTGIDISPRMLQIARNRCKRFQN
FT                   ITWRLTNGDLPFPDKSFDAILMVFCLRNVSNIQGFLCDAARVLKPGGRLVVCEFSHPRR
FT                   FVAPFYRLYLRYVLPRLAKLISSDPAAYEYLTESIEDWYEVDELAFMLEQCGFQNTSWK
FT                   RLSFGAVALHRALRGPE"
     ttggggacta acattcacat tgatatggta attcacggca aacacacggc agagattaga        60
     aaaatgttca atagggttgc ccaagcctac gatagaacaa atcttgtctt gtcattctta       120
     caggatgccc actggcgtcg ggctgcttgt aagatgcttg gggtaactgc cggggaagag       180
     gtgcttgatg tcggtgctgg tactggcgcg agcacccgaa cagttgccag gaccggtgct       240
     gccgtcacag gaattgatat atctccccgc atgctccaaa ttgcacgcaa tcgatgtaaa       300
     aggtttcaaa acatcacgtg gcgtctcacc aatggcgatc tgccgttccc tgataagagc       360
     ttcgacgcta ttctaatggt attttgtctc agaaatgtgt ccaatattca gggattctta       420
     tgcgatgctg cacgcgtctt gaagcccggt gggcggcttg tagtgtgcga gttcagccat       480
     cccagaaggt ttgttgcccc gttctacagg ttgtatctca ggtatgtctt gcccagactt       540
     gcaaaactta tctcgagcga tcctgctgca tacgaatatc ttacagaatc aatcgaggat       600
     tggtacgagg ttgacgagct tgcgtttatg cttgaacagt gtggttttca gaatacatcc       660
     tggaaaaggt taagctttgg ggcagttgcc ttgcataggg cgctgcgtgg tccggagtag       720
//

If you have problems or comments...

PBIL Back to PBIL home page