(data stored in ACNUC30630 zone)

EMBL: BX251410.PE59

BX251410.PE59        Location/Qualifiers
FT   CDS_pept        54106..55122
FT                   /transl_table=11
FT                   /locus_tag="TW064"
FT                   /product="putative polyprenyl diphosphate synthase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   transferase SCO4583 or SCD20.01 SWALL:Q9F2X8
FT                   (EMBL:AL392148) (336 aa) fasta scores: E(): 3.3e-37, 38.19%
FT                   id in 343 aa, and to Gluconobacter oxydans decaprenyl
FT                   diphosphate synthase DdsA SWALL:O82832 (EMBL:AB006850) (315
FT                   aa) fasta scores: E(): 2.4e-23, 32.55% id in 301 aa"
FT                   /protein_id="CAD66751.1"
FT                   /translation="MLVSGIFLSDILDPSGSLSDDISPALDRVEDLLLETVGDCHEIVS
FT                   HLLVSGGKRARPLLVLLTSCMGSGINDAVIRAAAGIELIHLGSLYHDDVMDNAYIRHGS
FT                   ITAHRLWGKSAAILAGDFLFAKAGVLGLNLDKRAIAVQTEAFQRMISGQLSETLGISDS
FT                   LDPLEAYIEVSRGKTGSLIAASAQVGAILGDASLSTLEPLRDFGESIGVAFQLVDDVID
FT                   LSGKSGKTPGSDIRAGVMSLPILLLSNAAKDDRDSAVLLEEIERVRRHSGACGSDDYSS
FT                   EMNAVLAHLRKHDVTARTLEIARTWGDKAKHALKKLPECAPRDALLAFVETVVSREF"
     atgcttgtgt caggtatttt tctgtccgat attcttgatc catctggcag tctgagtgat        60
     gatatttctc ccgctctcga tagggttgaa gatcttctgc tagaaaccgt tggtgattgt       120
     catgaaatag taagccattt gcttgtcagt ggcggcaagc gcgcccgtcc gcttttggtt       180
     ttgctcacat cttgtatggg ttctggcatt aatgatgctg ttatacgtgc tgccgcgggg       240
     attgagttaa tacacctggg ctctttgtat cacgatgatg ttatggataa tgcgtatatt       300
     cgtcatggat cgatcaccgc acatcgtcta tggggtaagt ctgcggctat tcttgcgggt       360
     gattttttat tcgccaaggc aggtgtgctc ggtcttaacc ttgataagcg tgcaattgcg       420
     gtgcaaactg aggcatttca gagaatgata tcgggtcagc tcagtgaaac tttgggtatt       480
     tctgacagtc ttgaccctct tgaggcttat atagaagttt cgagagggaa gacaggttct       540
     ttaatcgccg catccgctca ggttggggcg attttaggtg atgccagcct atcaactctt       600
     gagcccctgc gggattttgg agagagcata ggggttgctt tccagcttgt tgacgatgtg       660
     atcgatcttt cgggtaaatc cggcaagacc cctgggagtg acatacgcgc tggtgtcatg       720
     agtttgccga ttctgctttt gagtaacgcc gcgaaagatg acagagactc tgcggttttg       780
     cttgaggaaa tagagcgcgt gcggcggcat agcggcgcat gtgggagtga tgattattcg       840
     tcagagatga acgcggtttt ggcgcatttg cgtaagcatg atgtgaccgc acgcactctg       900
     gaaatcgcga gaacgtgggg agataaggcc aaacatgcgt tgaaaaaact tcctgaatgt       960
     gcccctcgtg atgcactttt ggcgtttgtc gaaacggttg tttctcgtga gttttag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page