(data stored in ACNUC30630 zone)

EMBL: BX251410.PE60

BX251410.PE60        Location/Qualifiers
FT   CDS_pept        55141..56484
FT                   /transl_table=11
FT                   /locus_tag="TW065"
FT                   /product="putative ferredoxin/ferredoxin-NADP reductase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ferredoxin/ferredoxin-NADP reductase SCO0681 or SCF15.02
FT                   SWALL:Q9RK35 (EMBL:AL132856) (454 aa) fasta scores: E():
FT                   1.3e-71, 43.55% id in 450 aa, and to Rattus norvegicus
FT                   NADPH:adrenodoxin oxidoreductase, mitochondrial precursor
FT                   FdxR SWALL:ADRO_RAT (SWALL:P56522) (494 aa) fasta scores:
FT                   E(): 7.4e-33, 35.16% id in 455 aa"
FT                   /protein_id="CAD66752.1"
FT                   /translation="MARIAVVGAGPAGIYSANLLLADESVERVDVFEALPAPYGLVRYG
FT                   VAPDHPRIKSVVSTLSDMLETPRMRLFCGVHFGQHLSLEDIKQRYNAVIFATGALRGAR
FT                   LDIPGIDARNSFSAADFVAWYDGHPDYPRTWPLSAKSVGIIGNGNVALDIARILVKQPE
FT                   ELETTEIPDNVYEDLKSSALSDVHIFGRRGPFDVKFTPLELRELGEVNGVDIVLNEDDF
FT                   QVKPDRLVKQMIIIDRVFSSWRARSGTSSTRRLHFHFYSVPKRVVVRDNCVSGLEYQQL
FT                   RPTIDACDCVAPPRDSDTRHEVVELDALYTAIGYYGSPLSDLPFDDISGIIPNDRGRVI
FT                   IEGKPLRGCYVTGWIKRGPVGLIGHTKSDAIETIVSMRQDKTAWWKPDTDSDISDLLGS
FT                   RGVNFTGVSGWRKLDAHEIYLGSLSGKTRKKVVPREEMYYISSRGSPS"
     ttggcgagga ttgcggtagt aggtgcaggt ccagcgggga tatattctgc caatcttctt        60
     cttgccgatg aatccgttga gcgcgttgat gtttttgagg cattaccagc gccttatggc       120
     cttgtaaggt atggtgttgc acctgatcat ccgaggataa agagtgttgt aagcaccctc       180
     agtgacatgt tagagacacc ccgtatgcgc cttttttgcg gtgtgcattt cgggcaacat       240
     ctttctttag aggatataaa acaacggtac aatgcagtta tttttgcaac aggcgccctc       300
     cgtggggcta gactcgatat tccgggaatt gatgccagga atagcttttc tgcggctgac       360
     tttgttgcct ggtatgacgg gcatccggat tacccacgga catggccttt gtcagcaaaa       420
     tcagttggca taatcggtaa cggcaatgtt gcgctggata ttgcgcgaat tctagtaaaa       480
     cagcctgaag aactagaaac aaccgaaata cccgacaatg tctatgaaga tttgaagagt       540
     tctgcattgt ctgacgtaca catatttggc cgtcgtgggc cttttgacgt aaagtttacc       600
     cccctcgaac tcagagagct cggcgaagta aacggtgtgg atattgttct taatgaagat       660
     gattttcagg taaagcctga tcgcctggtc aagcaaatga tcataatcga tcgtgtcttt       720
     tcctcatgga gggctcgctc cggtacatcc tcaaccaggc gattgcactt tcacttttac       780
     tcggttccca agcgggttgt tgttcgggat aattgcgttt ctggacttga gtaccaacag       840
     ctgcgcccca cgatagatgc ttgcgattgt gttgcgcccc cgcgtgatag tgacacgcgt       900
     catgaggtgg tagagcttga tgcgctttat acggcaattg gatattatgg ctcacccctt       960
     tccgacttac cttttgatga tattagtggc attattccaa atgaccgcgg cagggtaatt      1020
     atcgagggta agccacttag gggatgttac gtaacgggct ggataaagcg gggccctgtt      1080
     ggactgattg gtcatacaaa gagtgatgcc atcgagacaa tagtcagtat gcggcaggat      1140
     aaaactgcct ggtggaagcc agatactgac tctgatatat cagacctatt gggtagcagg      1200
     ggtgtgaact tcacgggtgt tagcggttgg cgcaagcttg atgcgcacga aatatatctc      1260
     ggcagtctct caggtaaaac acgtaaaaag gtagttccac gggaagaaat gtattacatt      1320
     tcttcccgtg gaagcccttc gtaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page