(data stored in ACNUC30630 zone)

EMBL: BX251410.PE61

BX251410.PE61        Location/Qualifiers
FT   CDS_pept        complement(56824..57795)
FT                   /transl_table=11
FT                   /locus_tag="TW066"
FT                   /product="putative iron-siderophore binding lipoprotein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   iron-siderophore binding lipoprotein SCO0494 or SCF34.13c
FT                   SWALL:Q9RK12 (EMBL:AL109974) (350 aa) fasta scores: E():
FT                   7.7e-19, 30.97% id in 339 aa, and to Corynebacterium
FT                   diphtheriae DtxR/iron regulated lipoprotein precursor Irp1
FT                   SWALL:Q46023 (EMBL:U02617) (355 aa) fasta scores: E():
FT                   1e-12, 31.02% id in 303 aa"
FT                   /protein_id="CAD66753.1"
FT                   /translation="MFGRKLLGALVALSLLTGCFGGKGDSESSSVLSKVETVFGEVTIP
FT                   RPKGHDLRVVALGWSDAEAALAVGIKPVAVYDWISFGNKGVGPWAEGLFGDVKPEVISR
FT                   GTDGLNWEQIHNLKPDLILNVRSNNDEKTYKRLSQIAPTVYGPPGTKSWVLNWRDQQRQ
FT                   VAKALGRVKEGEEAIKKTEKAIKDAQDPLYRGLKGAFVAKFAEYGVYLPGDGRWDLMQE
FT                   LGFTLEPKINELPKAGFYAKIPTDKLSWVDTDVLIVISIGTDDITKDALLSSLKAAKEG
FT                   RVIYANKDLANVLSASSALSIREAIKRISDKLREIAKKLRNK"
     gtgttcggta ggaagttact tggtgcgctt gttgcgctct ctctattgac aggctgtttt        60
     ggcggtaaag gtgactctga gtcgtcttct gttttgtcaa aagttgagac ggtgtttggt       120
     gaagttacca taccaagacc aaagggtcat gatcttaggg ttgtagccct cggatggtcc       180
     gatgctgaag cagcccttgc tgtgggaata aagcctgttg cggtgtatga ctggattagc       240
     tttggcaata agggtgttgg cccttgggcc gaggggctgt ttggtgatgt gaagccagaa       300
     gttatctccc gcggcacgga tggattgaac tgggagcaga tacataatct aaaacctgat       360
     ttaatcctga atgtccgcag caataacgat gaaaaaactt ataagcggtt gagtcagatt       420
     gccccaacgg tatatggacc tccggggaca aagtcatggg tgttaaattg gagggatcag       480
     caaaggcagg ttgccaaggc tcttgggcgc gtaaaagagg gtgaagaggc tatcaagaaa       540
     actgagaaag ccattaaaga tgctcaggat ccgctctata ggggattaaa aggggcattt       600
     gtagcgaaat tcgcggagta tggtgtgtat cttccgggtg atggtcgctg ggatcttatg       660
     caagagctcg gctttacact tgagccaaaa ataaacgagt taccaaaggc gggtttctat       720
     gccaaaatac caactgacaa actaagctgg gtagatactg atgtgctaat tgttatcagc       780
     atcggaactg acgatataac caaagatgct ttactgagtt ctctgaaagc ggcaaaagag       840
     ggaagggtta tatacgccaa caaagactta gccaatgtcc tgagcgcatc aagcgcactc       900
     agcattcgtg aggccatcaa gcgcattagc gataagctgc gcgagattgc caagaagctt       960
     cgtaataagt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page