(data stored in ACNUC30630 zone)

EMBL: BX251410.PE63

BX251410.PE63        Location/Qualifiers
FT   CDS_pept        complement(59134..59919)
FT                   /transl_table=11
FT                   /locus_tag="TW068"
FT                   /product="putative iron-siderophore uptake system
FT                   ATP-binding component"
FT                   /note="Similar to Escherichia coli ferric enterobactin
FT                   transport ATP-binding protein FepC or b0588
FT                   SWALL:FEPC_ECOLI (SWALL:P23878) (271 aa) fasta scores: E():
FT                   8.6e-42, 50% id in 250 aa"
FT                   /protein_id="CAD66755.1"
FT                   /translation="MITVDKLSFSYGKNKVLHDISIEIKRGSFIAIIGANGCGKSTFLR
FT                   SIAGLNRFEGDILLDKQHIRRLKPKNLAKHIAFLPQQVNLPEGLTIADLVSRGRYPHQS
FT                   ILHRWTKTDEEVVKESLQAVQASHISQRAIEAVSGGQRQRALIAMVLAQQTRILLLDEP
FT                   TTFLDIAYQYEILELLASLNRESKTIICSLHDLNQAARYASHLFVMGEGRIIASGEPKK
FT                   VITENLIENAFGLKSRIIDDPESNTPMIIPRKSENLKRL"
     atgattaccg tcgataagct ttcgttttct tacggaaaaa acaaggttct gcacgacata        60
     agcatagaga taaaacgggg ctcttttatc gcaattattg gcgctaatgg ctgtggcaaa       120
     tcaacttttt tacgctctat tgccggacta aatagatttg aaggggatat tctccttgac       180
     aagcagcata ttcgaaggtt aaagcctaag aatttggcca agcatatcgc tttcctacct       240
     caacaggtta atctcccgga agggctaacc atagcggatc ttgtgagcag ggggcgatat       300
     ccccatcaaa gcattctgca tagatggacg aaaactgatg aagaagttgt aaaagagtcc       360
     cttcaagcgg ttcaggcctc acatatttca caacgagcca ttgaagccgt ttcgggcgga       420
     cagcgccaga gggccttgat agcaatggta ttagctcagc agactcgtat tctcttactc       480
     gacgaaccaa cgacgtttct tgatatagct tatcaatatg agattcttga acttttagca       540
     tctctcaaca gagaaagcaa aactatcatt tgctcattac acgaccttaa ccaagctgca       600
     agatatgcat ctcacctgtt tgtgatggga gaaggccgga tcattgcctc gggcgaacca       660
     aaaaaagtta taacagaaaa cttgatagaa aatgcatttg gcttgaaatc aagaataata       720
     gatgatcctg aatctaatac acccatgatt attccccgca aatctgagaa tttgaaacga       780
     ttgtaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page