(data stored in ACNUC30630 zone)

EMBL: BX251410.PE64

BX251410.PE64        Location/Qualifiers
FT   CDS_pept        complement(59903..60937)
FT                   /transl_table=11
FT                   /locus_tag="TW069"
FT                   /product="putative iron-siderophore uptake system integral
FT                   membrane component"
FT                   /note="Similar to Escherichia coli ferric enterobactin
FT                   transport system permease protein FepG or b0589
FT                   SWALL:FEPG_ECOLI (SWALL:P23877) (330 aa) fasta scores: E():
FT                   1.2e-43, 39.93% id in 323 aa"
FT                   /protein_id="CAD66756.1"
FT                   /translation="MPQRVALRTYWTSCNLDTRALVVGSVFASLCVGLLFLSVSVGYTQ
FT                   TSFADMWSALTGNGDIELRQTILEWRLPRVLSAIFVGSSVALAGALFQSLTRNPLCSPD
FT                   IIGFNAGAFAGVIIAAELFGGERTPSTLSALAGGFIVAILVYFLSLTRTFRGLRLVIVG
FT                   ISLNAIISSFNTYMKSIINVEISQNISIWGVGSLSLITWSDALLLYLTLIACVSLAVIV
FT                   IPKMRVLEMGDDNAASLGVSARSTLTMMIVIAVVLTAVSTTVVGPISFVALTAPHIAKF
FT                   LVGSKAINIFPTIAVGGFLLAASDLIARTIIAPSQLPTGVVTIVFGGAYLLYLSIRGAN
FT                   DYRR"
     atgccacagc gggtggcgct gagaacgtat tggacaagtt gcaatctcga cactcgtgct        60
     ttggtggtcg ggtctgtttt tgcatctcta tgcgtgggat tactgtttct atcagtcagc       120
     gttggctata cgcaaaccag ctttgcggat atgtggagtg cattaactgg caacggagat       180
     atcgaattac ggcaaacaat tcttgaatgg agacttccgc gggtgttatc agcaattttc       240
     gttggatcct ctgttgccct agccggagca ctgtttcagt ctctaacgag aaaccctctt       300
     tgcagtccag atattattgg attcaatgcg ggtgcatttg ccggggtaat aatagctgca       360
     gagctttttg gtggagaaag aacaccgtca acactttcag cgctagccgg tgggtttatt       420
     gttgccattc ttgtatattt cctgagcttg acaagaacat ttcgcgggtt acgtttagtt       480
     atagtcggca ttagccttaa cgcaataatc tcatcgttca atacctacat gaagtcaatt       540
     atcaatgttg aaatcagtca gaacataagc atatggggtg ttggaagcct gagcctaata       600
     acgtggagtg acgcactgct cttatacctg accttgattg catgcgtcag tttggccgtt       660
     attgttattc ctaaaatgcg agttcttgaa atgggcgatg acaatgccgc aagcctgggc       720
     gtttcagcaa gaagtacatt gacaatgatg attgtcattg cggttgtatt gactgcggtt       780
     tcaacgacag tggttggccc aatcagtttt gtggccctta ccgctccgca tatcgcaaag       840
     tttcttgttg gcagtaaggc aattaatatt ttcccaacta tagctgttgg agggttctta       900
     ttggccgcat cagatctaat tgcaagaaca attatcgcac cgtcgcaatt accaaccggg       960
     gtcgtgacaa ttgtatttgg cggggcgtat ctgctttatc tatctatcag gggagcaaat      1020
     gattaccgtc gataa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page