(data stored in ACNUC30630 zone)

EMBL: BX251410.PE65

BX251410.PE65        Location/Qualifiers
FT   CDS_pept        complement(60943..61908)
FT                   /transl_table=11
FT                   /locus_tag="TW070"
FT                   /product="putative iron-siderophore uptake system integral
FT                   membrane component"
FT                   /note="Similar to Escherichia coli ferric enterobactin
FT                   transport system permease protein FepD or b0590
FT                   SWALL:FEPD_ECOLI (SWALL:P23876) (334 aa) fasta scores: E():
FT                   5.2e-33, 40% id in 305 aa"
FT                   /protein_id="CAD66757.1"
FT                   /translation="MAGPVFRLSLVFGSVVIVGLCYLALFLDGSSVGQLIDAVFGGGDD
FT                   FKDVVLRDFRVPRILLAILVGAALSVAGAIMQVVTRNPLADPGLLGITHGAYLAIVLGF
FT                   LVGYVTPFWNLLIVPLLGASIAAGLVYFIGNIVTPGQLILVGVALTALISGLARSVALI
FT                   NQDIFDVIRHWAVGSLDYKKIDTVYISFPLILAGILIALMMMSSLNVLSIDKDISKSLG
FT                   VGKTALWSYIAVIALSAGSTAAVGPISFLALAAAHISRVISGPNLLRIIPLCLITGPIV
FT                   LLTADTLGRVLTPTGLDAGVVVPFLGAPILIFLSRKVKVF"
     gtggcagggc cagtttttcg tttgagttta gtattcggca gcgtcgttat tgtcgggctt        60
     tgttatttgg ccctttttct cgatggctca agcgtcggtc aattgattga cgcggtgttc       120
     gggggtggag acgacttcaa agatgtagtc ctgcgagatt ttagagttcc tcgtatcttg       180
     ctggcaattc ttgttggggc agcactctca gttgctggcg caattatgca agtggttacc       240
     cggaatccat tggccgatcc ggggctgctt ggaataactc atggggcata tcttgcgatt       300
     gtccttgggt ttttggttgg ctatgtaacg cctttctgga atttgctgat cgttcctctg       360
     ttgggtgcct caattgctgc tgggcttgtt tattttattg ggaatattgt cactccgggg       420
     caattgatct tggtcggagt tgcattaacc gcgctgatta gcggactggc acgttcggtg       480
     gcgttaataa atcaggatat ttttgacgtg atccgccact gggcagttgg gtcactcgat       540
     tacaaaaaaa tcgacacggt gtacatatca tttcctctca tcctggccgg aatactaatc       600
     gcacttatga tgatgagctc actgaatgtt ttgtcaattg ataaagacat atcaaaatcg       660
     cttggcgttg gaaaaactgc actgtggtca tatattgcag ttatagcgct tagcgcagga       720
     tctaccgcgg cagtcggtcc gattagtttc ttggcgcttg cagcggcaca tatctcccgg       780
     gttatatcag gacccaattt gctcagaatt attcctcttt gtttgataac tggcccgatt       840
     gtgttactga ctgcagacac gcttggtcgg gttctaacac caaccggact agacgctgga       900
     gtggttgtgc ctttcttggg tgcgcccatt ctgattttcc tgtcaagaaa ggtaaaagtc       960
     ttttga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page