(data stored in ACNUC30630 zone)

EMBL: BX251410.PE66

BX251410.PE66        Location/Qualifiers
FT   CDS_pept        62354..62647
FT                   /transl_table=11
FT                   /locus_tag="TW071"
FT                   /product="putative regulator"
FT                   /note="Similar to Staphylococcus aureus cadmium efflux
FT                   system accessory protein homolog cadC SWALL:CADF_STAAU
FT                   (SWALL:P37374) (121 aa) fasta scores: E(): 3e-07, 37.89% id
FT                   in 95 aa"
FT                   /protein_id="CAD66758.1"
FT                   /translation="MGLSRKNAQSAEKLFKCLASASRLKILFVLLESEKSVGDITVDCD
FT                   MSQPLVSQHLRHLRDNNLVYTKRHGKQVYYSIADEHIKHVVADCIQHVQHET"
     atgggcttat ctaggaaaaa cgcgcagagc gcagaaaaac ttttcaaatg ccttgcatcc        60
     gcgtcaagac tcaagatact gttcgttttg cttgaatctg agaagtcagt gggtgacata       120
     actgtggatt gtgatatgag tcagcccctt gtctctcagc atttgcgcca tcttagggat       180
     aataacttgg tttatacaaa aagacacgga aagcaagttt attattcgat agcagatgag       240
     catataaaac atgttgttgc tgattgcata cagcatgttc agcacgaaac ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page