(data stored in ACNUC30630 zone)

EMBL: BX251410.PE69

BX251410.PE69        Location/Qualifiers
FT   CDS_pept        65832..67328
FT                   /transl_table=11
FT                   /locus_tag="TW074"
FT                   /product="putative phospholipase"
FT                   /note="Similar to Escherichia coli cardiolipin synthetase
FT                   Cls or Nov or b1249 SWALL:CLS_ECOLI (SWALL:P31071) (486 aa)
FT                   fasta scores: E(): 4.9e-21, 30.64% id in 496 aa"
FT                   /protein_id="CAD66761.1"
FT                   /translation="MKPYLFILAALLLADLVIRIGCLFVVPRNRRPNSANAWLLTIFFL
FT                   PFIGWFLFLIIGSYKLPKSRREKQALINQLVANALSDHAVLDNVDLQWLPSLVKLNRNL
FT                   GSMPMVAGTRVHILTDTSVIMEQMVSAIDSAKSSVHVEFYIFSLDEFTQGFFTSLENAT
FT                   ARGVKVRVLYDHIATLRVPGYLNMKSRLKRNGIEFYPMLPIQPFKLKYQRPDLRNHRKL
FT                   LVIDDAIAFVGSLNIIDPFYNTRGRKKMFWQDAMLRLEGPVISGISAVFVSDWYAETGQ
FT                   LLRDYRIVKTSSGDSFTENRTQSNSVDRSCPSTNNVLCQVVPSGPGFEGENNLQLFLML
FT                   LYASQKRVAITSPYFVPDEAMTLAIVSATKRGVSVELFLSENHDQKIVYHAQCSYYEQL
FT                   LRSGVKIWLYRAPNFLHSKYVTVDDDVAVFGSSNFDMRSFNLNMEMSLLLYSKEFVAKL
FT                   QAVEQENRANSSLLTLDEWMHRGKMDRLKDNLARLTSALQ"
     gtgaagccct atttgtttat tttggcggcc ctgctattgg ccgaccttgt catccgtatt        60
     ggctgccttt ttgttgttcc tcgcaataga cgtcctaatt ctgccaacgc ctggcttctc       120
     acaatattct ttctgccgtt tattggatgg tttctttttt tgataatagg cagctacaag       180
     ctcccaaaat caagaagaga aaaacaggct cttataaacc agcttgttgc aaatgcactg       240
     tcagatcatg cagtattgga caatgtagat ctgcaatggc taccatctct ggtaaaacta       300
     aacagaaatc ttggatctat gccgatggtt gcgggaactc gtgtacatat tcttactgat       360
     acaagtgtga ttatggagca gatggtatct gccattgatt cagctaaaag cagtgtacac       420
     gttgagttct acatcttttc gctggatgaa tttacgcagg gctttttcac aagccttgaa       480
     aatgcgaccg cccgcggggt aaaggttcgg gttttatatg atcacatcgc aactttgcgc       540
     gtccctggat atctgaatat gaagtctcgc cttaagcgca atgggattga attttatccg       600
     atgcttccga ttcagccctt caagttgaaa tatcagaggc ctgacctgcg caatcatcga       660
     aaattgcttg taattgatga tgcaattgca tttgttggat cgctaaacat tattgatcct       720
     ttttataaca cgaggggtcg caagaaaatg ttttggcaag atgcgatgct gcgccttgaa       780
     ggacccgtta taagcgggat aagcgcggtt tttgtctctg attggtacgc agaaacaggc       840
     cagctcctga gagactacag aattgtaaaa acttcatccg gcgattcctt cacagaaaac       900
     cgcacacaat caaacagtgt tgataggagt tgcccgagta caaataacgt tttatgtcaa       960
     gtagttcctt ctggtcctgg atttgagggg gaaaataacc tccaattgtt tctaatgctc      1020
     ctttatgcat cgcaaaaacg ggttgcaatt acatcaccgt acttcgtgcc ggacgaggca      1080
     atgactttag caatcgtgtc ggcgactaaa aggggggtta gtgtcgaact gtttttatct      1140
     gaaaaccatg accaaaaaat tgtttaccac gctcagtgtt cgtactacga acagctattg      1200
     agaagcggcg taaagatttg gctataccgt gcaccaaatt tcttacacag caaatatgta      1260
     actgttgatg atgatgttgc cgtttttgga tcaagcaatt ttgatatgcg ctctttcaat      1320
     ctgaatatgg aaatgtcact gttgctctac agcaaggaat ttgttgcaaa actgcaggcg      1380
     gttgaacagg aaaaccgagc aaatagctcc ctgctcaccc tcgatgaatg gatgcaccgc      1440
     gggaaaatgg accgcttgaa agataatcta gctagactta catccgccct gcaatag         1497
//

If you have problems or comments...

PBIL Back to PBIL home page