(data stored in ACNUC30630 zone)

EMBL: BX251410.PE7

BX251410.PE7         Location/Qualifiers
FT   CDS_pept        8894..9274
FT                   /transl_table=11
FT                   /locus_tag="TW007"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO3872 or SCH18.09c SWALL:Q9KXX6
FT                   (EMBL:AL357152) (185 aa) fasta scores: E(): 0.0026, 30.5%
FT                   id in 118 aa"
FT                   /protein_id="CAD66699.1"
FT                   /translation="MNTKLVKSSSSQAVLRLGSINVVSAARTAFVFSLAFSVVMFLLIL
FT                   MLYMFLNFAGVFNISAVGGTPEGAPADFTLSNAISPWTVLIFSLILAGTNVFTFTTGAI
FT                   IFSVIYNVIARITGGLRFTFYR"
     gtgaatacaa agcttgtaaa aagctcctcc tcacaggcgg ttctccgcct tgggtcgatt        60
     aacgttgtct ccgcagccag gactgccttt gtgttctcgc ttgccttttc ggtagttatg       120
     ttcttgctta ttttgatgct ttatatgttt ctaaattttg ctggggtgtt caacattagc       180
     gctgtcggtg gcacgcctga gggtgcccct gcagatttca ccctgagtaa cgctataagc       240
     ccgtggactg tgttaatttt ttctttgatt ttggccggaa ccaatgtctt tacattcaca       300
     accggtgcaa ttattttttc tgtgatctac aatgttattg cccggattac agggggtttg       360
     cgatttactt tctatcgctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page