(data stored in ACNUC30630 zone)

EMBL: BX251410.PE70

BX251410.PE70        Location/Qualifiers
FT   CDS_pept        67380..69902
FT                   /transl_table=11
FT                   /locus_tag="TW075"
FT                   /product="putative Clp-family ATP-binding
FT                   protease/regulator"
FT                   /note="Similar to Bacillus subtilis negative regulator of
FT                   genetic competence ClpC/MecB SWALL:CLPC_BACSU
FT                   (SWALL:P37571) (810 aa) fasta scores: E(): 3e-152, 56.66%
FT                   id in 810 aa, and to Streptomyces coelicolor putative
FT                   Vlp-family ATP-binding protease SCO3373 or SCE94.24c
FT                   SWALL:Q9S6T8 (EMBL:AL049628) (841 aa) fasta scores: E():
FT                   7.6e-189, 65.87% id in 838 aa"
FT                   /protein_id="CAD66762.1"
FT                   /translation="MGEDMFERFTDKARRVIVLAQEEARTLSHNYIGTEHVLLGLISEG
FT                   DGIAAQALESLDITLERAREGVAELIGRGQNATSGHIPFTPRAKKVLELSLREALQLGH
FT                   NYIGTEHILLGILHEGEGIAAQVLVNMGAELPAIQQRVMHLLEDGREQEPVSVGPSESG
FT                   KISGSQILDQFGRHLTRAAKEGKLDPVIGREKEIERVMQVLSRRTKNNPILIGEPGVGK
FT                   TAVVEALAQAIVNGDVPVNLRNKQVYSLDLGSLIAGSRYRGDFEERLKKVTKEIRSRGD
FT                   IIVFIDEIHSLVGAGSAEGAIDAATILKPLLARGELQTIGATTLDEYRKNIEKDSALER
FT                   RFQPVNVSEPSIPMCIQILKGLRDRYEAHHKVKITDEAIYAAVTLSSRYINDRFLPDKA
FT                   IDLIDEAGARLRLSVLSNPSQLRAVEKKILAVVARKDKAVEKQDFDKVGELKRKEKALR
FT                   AELRKIKRDYENGNIASAGTVDEGLIAEVLASATGVPVFRLTEDESVRLMMMERSLHQR
FT                   VIGQDEAISSLSRAMRRTRAGLKDPNRPSGSFIFAGPTGVGKTELAKALAEFLFDNEDA
FT                   LVSLDMSEYGERHTVSRLFGAPPGFVGFEEGGQLTEKIRRKPFSVVLFDEIEKAHPDVF
FT                   NSLLQILEEGRLSDAQGRMVDFRNTIIVMTTNLGSRDIASGPVGFQSGDGSFLAYEAMK
FT                   AKVNEELRRSLKPEFLNRIDEVIVFPPLNRDELLQILKIFIKKLDDRLRDRTMRLSVTD
FT                   AALEQLVQIGYEPTMGARPLRRAVQREVEDRISEKILLGEIKPNQEIEMDFVNDNFTIV
FT                   SRDMDYPLSPLVPSVTTGLVTPDLASHV"
     ttgggtgagg atatgtttga aaggtttaca gataaagccc gccgggttat agtactggcg        60
     caggaggaag cgcgcacgct tagccacaat tacattggca ccgagcatgt tcttcttggc       120
     cttattagcg agggtgatgg tattgccgcc caggcgcttg agagtcttga tattaccctt       180
     gagcgtgcgc gcgagggcgt ggcggaacta ataggtcggg gtcagaacgc aacatccggg       240
     catatcccgt ttacgcctcg tgcgaaaaag gttctagagc tttcgctccg cgaggctctt       300
     cagcttggtc acaattacat tggcactgag catatactcc ttgggattct tcatgagggt       360
     gagggtatcg ctgcacaggt actggtgaat atgggggctg aactgcctgc aattcagcag       420
     agggttatgc accttttaga agatggaaga gaacaagagc ccgtttcggt tggcccatct       480
     gagtcaggaa aaatttcagg cagtcagata cttgatcaat tcgggcgaca cctcacgcgt       540
     gccgcgaaag agggcaagtt ggacccagtt attggccgtg agaaggaaat agagcgcgtg       600
     atgcaggtgc tctcgcgcag aacgaagaat aacccaatcc taatcggtga gcccggtgtt       660
     ggaaaaactg ctgtcgtcga ggctttggct caagcgatag tcaatggtga tgttccggtc       720
     aatttgcgca acaagcaagt gtactcgctt gatttgggtt ctcttatcgc tggtagcagg       780
     tacaggggtg attttgagga acgcctcaag aaggttacga aggaaatacg ttcacgaggg       840
     gacattatcg tttttataga tgagatccat tcccttgttg gggccgggtc tgctgagggt       900
     gctatcgatg cagcaactat cctgaaaccc cttctggccc gtggtgagct tcaaacaatt       960
     ggcgcaacaa cccttgatga gtatcgcaag aatattgaaa aggattctgc tctggaaagg      1020
     cgcttccagc ccgtcaacgt gtcagagccc agcataccaa tgtgtatcca gatactgaaa      1080
     gggttgcgtg atcgctatga ggcccatcat aaggtgaaaa tcaccgatga ggcaatttat      1140
     gctgcagtta ccctttcgag tcgttatata aatgataggt ttttaccaga caaagccata      1200
     gacttgattg atgaggccgg cgccaggctg agactgtctg ttttgtctaa tccgagccaa      1260
     ctgcgcgctg tcgagaaaaa aattctcgct gttgttgcca ggaaagacaa ggcggttgaa      1320
     aaacaggatt tcgataaagt tggcgagcta aaacggaaag aaaaggccct aagagctgag      1380
     ttacggaaga taaagcgtga ctatgagaat ggcaatattg caagtgccgg cactgtagat      1440
     gagggcttga tcgctgaagt gcttgcgtca gcgactgggg ttcccgtttt tcgactaacc      1500
     gaagacgagt ccgtgcgtct gatgatgatg gaaagaagtt tgcatcagcg tgtgattggt      1560
     caggacgagg cgatttcgtc tctgtcaagg gcgatgcgcc gaacgcgcgc tggattgaag      1620
     gatccaaacc gaccttccgg atcgtttatt tttgccggcc cgaccggtgt cggaaaaacc      1680
     gagctggcca aggctcttgc cgagtttctg tttgataatg aagacgccct tgtaagtctt      1740
     gacatgtcag agtacggaga gcggcacact gtatccaggc tttttggagc cccgcccgga      1800
     tttgttggtt tcgaagaagg cggacaactg acagagaaaa tacgccgcaa gccctttagc      1860
     gttgttttat ttgatgaaat tgaaaaagcc catccggatg tttttaactc gcttttgcag      1920
     attttggaag aaggtcgtct gagtgacgcc cagggccgta tggttgattt tagaaatacg      1980
     ataattgtta tgacaactaa ccttggcagt cgcgatatag catcaggccc tgtcgggttt      2040
     cagtcgggtg atggtagttt tttggcctat gaggctatga aggccaaggt taatgaggaa      2100
     ctgaggcgca gtttaaagcc ggagtttctc aatcgtattg atgaagttat agttttcccg      2160
     cccctcaata gagacgagct tctgcaaata ctgaagattt ttatcaaaaa gctcgatgac      2220
     cgtttgcgcg ataggaccat gcgtctttct gtgacagatg ctgccctaga acagttggtg      2280
     caaattggct acgaacccac catgggagca aggcccttgc gccgagcggt tcagcgcgag      2340
     gttgaggata ggatttctga aaagattctg ctgggcgaga taaagccaaa tcaagagata      2400
     gaaatggact ttgtgaatga taatttcacg attgtatcaa gggatatgga ttacccccta      2460
     tctcctcttg tgccgtcagt gacaacgggt ctcgttactc cggatcttgc aagtcacgtc      2520
     tag                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page