(data stored in ACNUC30630 zone)

EMBL: BX251410.PE72

BX251410.PE72        Location/Qualifiers
FT   CDS_pept        72230..72775
FT                   /transl_table=11
FT                   /locus_tag="TW079"
FT                   /product="putative secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66764.1"
FT                   /translation="MKRVYLRRRIMLSMLIVLPLIVAVFFATGSPGHERPALPQPTPIK
FT                   VADDRCTEEQIAVFVTSDRESYTKNRLPAFRASVRNIGISPCRINVGTASQSYRIIRDG
FT                   KLIWDSKICLVDPTNALVMLLPKQTLTSQTLTWHREIANISDCGKDFSVRPKATPGEYT
FT                   VEFSIDGFSSSKYNFVLQ"
     atgaaaaggg tttatcttcg tcgacgtatt atgctatcga tgctaattgt tctgcctttg        60
     attgttgcgg tcttttttgc tacaggatct ccagggcatg agaggccggc gttgccccaa       120
     cccacaccga ttaaagttgc cgacgataga tgcaccgaag agcagatcgc ggttttcgta       180
     acatccgata gagagtctta tacaaaaaat cgacttccag catttagggc ttcagttcgc       240
     aatataggga tatccccgtg tcgcatcaat gtaggtactg catctcagag ctatcgtatt       300
     attcgtgatg gcaaattgat atgggatagt aagatttgcc ttgttgaccc aacaaacgcc       360
     ctagtgatgc ttttaccaaa acagactctg acatcacaaa ctctcacgtg gcacagggaa       420
     atcgcaaata tttctgattg cggaaaggac ttttctgttc gcccaaaggc aactcccggt       480
     gagtatacgg tggagttctc tattgacggt tttagttcat caaagtataa ctttgttcta       540
     cagtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page