(data stored in ACNUC30630 zone)

EMBL: BX251410.PE76

BX251410.PE76        Location/Qualifiers
FT   CDS_pept        complement(81523..82884)
FT                   /transl_table=11
FT                   /locus_tag="TW083"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Synechocystis sp. serine esterase sll1284
FT                   SWALL:P73192 (EMBL:D90904) (204 aa) fasta scores: E():
FT                   0.0001, 29.01% id in 193 aa"
FT                   /protein_id="CAD66768.1"
FT                   /translation="MNNFDASAPIDECRVLGHVNENRFLLLAMHGYSGNNQVMYDTVKS
FT                   FMPQEIQAGISIVSLRAPIDLSSVSEGPDEGFAWFLFDESGSYKNSYKTLSQSAKQILS
FT                   WLDTKKPAGIGLLGFSQGGAMCMELLRAAPEKFDFAVNISGFVWGPPRRDDSVLAGGLE
FT                   KRVRYGDSLVTERRRTEVFWGLGKEDTILPYKVWEATQAWLLSVTNPEIRIYPELAHKI
FT                   CDEEVRDISSFLLRHLENRVGRITPAIRCRWKEQDLTGKNVVLLLHGYGSSESELIRWT
FT                   GPSAAQVSLDEQTEQYLPENTTYISLQGPIPEAMGYAWFDRNATDVGDAVNSVVNWFCD
FT                   LVQTFGKPARVGLLGFSQGGAVCIELLLRHPELFDLAVVLSGFAVGSTTSSAKKPVLWI
FT                   RGDSDSVIDENRVLSTKYVLEKSSELTEECLSGLTHEITPEVIARASKYLRAHL"
     gtgaataact ttgacgcaag cgcccccatt gatgaatgca gagtgctcgg tcatgtgaat        60
     gagaaccgct tcttactatt agcgatgcat ggatacagtg ggaataatca ggttatgtac       120
     gacacggtca aaagttttat gccgcaagag attcaggctg gaatcagtat cgtctccctg       180
     agggcgccaa ttgatctctc aagcgtcagt gaaggccccg acgaaggatt tgcctggttt       240
     ctgtttgatg aatctggttc atataaaaat tcatataaaa cactttcgca gagcgcgaaa       300
     cagattctta gctggctgga tacaaaaaaa ccagctggta ttgggcttct tggttttagt       360
     caaggcgggg caatgtgcat ggagctcttg cgagcggcac ccgagaaatt tgactttgcg       420
     gtcaatataa gtggatttgt ctggggtccg cctaggagag atgacagtgt tctggccgga       480
     ggtcttgaaa aaagagttcg ctacggcgat tctcttgtga cagaaaggcg tagaacagag       540
     gttttctggg gtcttggaaa agaagacacg atactgccat acaaggtatg ggaggcaacc       600
     caggcctggc ttcttagcgt aacaaatcct gaaatacgta tatacccaga gcttgcccac       660
     aagatctgcg acgaagaagt gcgtgatata tcgtcgtttc tccttcggca tcttgagaat       720
     cgggtgggtc gtataactcc agcgattcgt tgcagatgga aagagcaaga cctaactggt       780
     aaaaatgtag ttcttttgct gcacggatat ggctcatcag agagtgaact tattcgatgg       840
     actggcccct cggcggcgca agtgagcctg gatgaacaga cagaacagta tcttcctgaa       900
     aatacgacct atatatcact gcagggaccc ataccagagg caatgggata cgcgtggttt       960
     gacaggaatg cgactgatgt aggtgatgca gttaattctg ttgttaattg gttttgtgat      1020
     ttggtgcaaa cttttggcaa accagccagg gttgggcttc ttggttttag tcaaggcggg      1080
     gctgtttgca ttgagttgct attgagacat ccggaactat ttgatttggc tgttgttttg      1140
     agtggctttg ccgttgggtc aaccacttct tccgcaaaaa aaccagtcct ctggatacgc      1200
     ggtgactctg actctgtaat agatgagaat cgcgttctgt caaccaaata cgtattggag      1260
     aagtcttcag aactcaccga agaatgcctg agtgggctca cgcatgaaat aaccccagaa      1320
     gtgattgccc gcgcgagtaa atatctcaga gctcaccttt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page