(data stored in ACNUC30630 zone)

EMBL: BX251410.PE8

BX251410.PE8         Location/Qualifiers
FT   CDS_pept        complement(9640..10332)
FT                   /transl_table=11
FT                   /locus_tag="TW008"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Thermoanaerobacter tengcongensis thiamine
FT                   pyrophosphokinase Thi80 or Tte1497 SWALL:Q8R9T9
FT                   (EMBL:AE013107) (211 aa) fasta scores: E(): 2.5e-09, 29.68%
FT                   id in 192 aa, and to Bacillus subtilis YloS protein
FT                   SWALL:O34664 (EMBL:Z99112) (214 aa) fasta scores: E():
FT                   5.7e-08, 30% id in 210 aa"
FT                   /protein_id="CAD66700.1"
FT                   /translation="MLGMGVCYIYGAGEHFTPPEEVGMHDLVIAADGGLMQLKKHGARI
FT                   DLYVGDLDSIESIPINIDRVILPREKDKTDMMQAALIGAERGFRTFCIFGGTGGRLDHT
FT                   IGNIQLLAELTNMGYSVFIVGKYDVVTAIRNNEIYFPSHFTGNISIFPHSGDASGVYEE
FT                   GLKYALNNAHIPGTFNGVSNEFIGVKSRVAVESGMLLVVYERQGGRMHLNISTCAMTAG
FT                   NQIQKPSG"
     gtgcttggaa tgggtgtttg ctacatatat ggtgccggtg agcactttac accccccgaa        60
     gaagtgggga tgcacgactt ggttatcgcg gctgatggcg gcttgatgca gctcaagaag       120
     catggtgcgc gcattgatct ctatgtcggc gaccttgatt caattgagtc tattccaata       180
     aacattgatc gggtgatttt gcccagagaa aaagataaaa ctgacatgat gcaggcagcc       240
     ctgattggtg ccgagcgggg ctttagaact ttttgcatat ttgggggtac cggtgggcgg       300
     cttgaccata ccattggaaa tatccagcta ctggccgaac tgacaaatat gggatatagc       360
     gtgtttattg tcgggaagta tgatgtggtg acagcgatcc gaaacaatga gatttacttt       420
     ccgtcgcatt tcaccggcaa tatctcaatc ttcccgcact ccggcgatgc cagcggggtt       480
     tatgaggagg ggctaaaata tgccctgaac aacgcacata taccgggtac ctttaatggt       540
     gttagcaatg agtttatagg ggtgaagagc agggttgcgg tcgagtctgg catgcttctt       600
     gtggtgtacg agcgccaagg cggcagaatg catttgaaca tttcgacgtg tgcgatgacg       660
     gcaggaaatc aaatacaaaa accaagcggt tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page