(data stored in ACNUC30630 zone)

EMBL: BX251410.PE80

BX251410.PE80        Location/Qualifiers
FT   CDS_pept        85986..86699
FT                   /transl_table=11
FT                   /locus_tag="TW087"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   protein SCO1829 or SCI8.14 SWALL:Q9RJ39 (EMBL:AL132644)
FT                   (290 aa) fasta scores: E(): 0.37, 25.79% id in 252 aa"
FT                   /protein_id="CAD66772.1"
FT                   /translation="MPKAYFKLSSLLLLAPFLVVSFCFVYLGFWQLSRSYSPQDDPGTG
FT                   IVTDFSVHTHILHGQRIALEGQLIPEDTLIVSDRYEKGESTWWLVARYNTPNGALPAVL
FT                   GYGDRNAVATACSHLKQTKVVASQKISGRFYYDEPPDSLKLPESGTLNRMSSAAMINMW
FT                   RKFSDPRVFSGFVVLDDPPGLGLGRVSILPGQPARINWLNIFYAVEWFLFAGFCLYVWF
FT                   YLVRTPEIESCAKRD"
     gtgcctaagg catatttcaa gctctccagt ctattactcc tggcgccatt tcttgtggtt        60
     tcattttgtt ttgtttacct tgggttttgg caactttcgc gctcatattc gcctcaagat       120
     gatccgggaa cgggtatagt cacagatttt tcggtacata cacatatctt gcacggacag       180
     cggattgcct tagagggtca acttatccca gaagataccc ttattgtgtc cgatagatat       240
     gaaaagggtg agtcaacctg gtggcttgtt gcaaggtaca ataccccaaa tggagcttta       300
     ccggcggtgt tggggtatgg agaccgtaat gctgtggcca ccgcatgttc acacttgaag       360
     cagaccaagg ttgtcgcttc gcagaagata tcgggtcgtt tttattacga tgaaccaccc       420
     gactctttga agctgccgga atcaggcacg ttaaacagga tgtcttctgc ggccatgata       480
     aatatgtggc gcaaattttc tgatccaaga gttttttctg gttttgttgt tctggacgac       540
     ccgcctgggt taggcttggg aagagtgtcg attttgcccg ggcagcccgc tcgaataaat       600
     tggctgaata ttttttatgc tgtagagtgg ttcctgtttg ccgggttttg cctgtatgtg       660
     tggttttatt tagtcaggac ccctgagatt gagagttgcg cgaaaagaga ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page