(data stored in ACNUC30630 zone)

EMBL: BX251410.PE81

BX251410.PE81        Location/Qualifiers
FT   CDS_pept        86765..87202
FT                   /transl_table=11
FT                   /locus_tag="TW088"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Corynebacterium glutamicum hypothetical
FT                   membrane protein Cgl2499 SWALL:BAB99892 (EMBL:AP005281)
FT                   (118 aa) fasta scores: E(): 0.0015, 31.53% id in 130 aa"
FT                   /protein_id="CAD66773.1"
FT                   /translation="MPKGSSEQEPVRQPVCPGDNSVLSAFRMYRAASSITGVLLILVCV
FT                   EMFLKYILGVQVFALTGGALVELYHVDAPEPSGLNLSVMTLIFHGWFYVFYLWSDLYLW
FT                   SKVRFGFALFIVIALGGVVPLMSFVVERYVYKKLSKRFVST"
     ttgcctaagg gttcctctga acaagagcct gtacgtcaac ccgtctgtcc gggtgataat        60
     tctgtgctct ctgcctttag gatgtatcgc gccgcatcca gcataactgg ggtgcttcta       120
     atcttggtct gcgttgaaat gttcctcaaa tatatattgg gagtgcaggt ttttgcactg       180
     actggtggtg ctttggtcga gctctatcat gtagatgccc ctgagccatc agggcttaac       240
     ttatccgtta tgaccctgat attccatggt tggttttatg ttttctattt gtggtctgat       300
     ctctatctct ggagtaaggt ccgttttgga tttgcactat ttatcgttat cgctctcggc       360
     ggagttgtgc ctcttatgag ttttgtggtc gagcggtatg tttacaagaa actttcaaaa       420
     cggtttgtgt cgacatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page