(data stored in ACNUC30630 zone)

EMBL: BX251410.PE83

BX251410.PE83        Location/Qualifiers
FT   CDS_pept        88815..91046
FT                   /transl_table=11
FT                   /locus_tag="TW090"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="Similar to Bacillus subtilis ATP-dependent DNA
FT                   helicase PcrA SWALL:PCRA_BACSU (SWALL:O34580) (739 aa)
FT                   fasta scores: E(): 1.1e-72, 41.42% id in 758 aa"
FT                   /protein_id="CAD66775.1"
FT                   /translation="MTIPADLLKGLNPQQVEGVCYRGPTLLISAGAGSGKTKVLTHRIA
FT                   GFLATGEASCDQILAITFTNKAASEMRHRTGDLVGLSVRDMQISTFHSVCVRILRECVG
FT                   HLGKAKNFTIYDAADQRAIIKQICQSTDTFGLTASMVASQIGLLKNQMHTPDTYSRCLA
FT                   SNSTNGNSVTSITLQREQFILHVFRRYQEILKEANAFDFDDLISETVFLLQKSPEISAM
FT                   YRNRWKYLLVDEYQDTNHAQYRLILELTKGDKSDMSLTAVGDSDQSIYAFRGADIANIV
FT                   NFENDFPDCHTILLEQNYRSCQNILLAANALISNNQNRKDKNLWSELGAGEKVVAYCAS
FT                   SAEEEGRFVADRVRHLVDQGESLSDIAVFYRSNTQSRAIEESLIRQSIPYRVVGGTKFY
FT                   ERAEIKDILAYLTVIVNPDDTLALRRILNVPKRGVGTVSENRLVEFASARGITLMQALS
FT                   RIDEINIQPSAKSALRDLFYLLNRFAGSSMPANELLDDLLKATDLLSRFNNTDDPQNEA
FT                   RKINIGDFVDSVEDFAKENPGGTLSDFMTNIALMTSYDQSDDAPGQITLMTLHMAKGLE
FT                   FDFVFLTGLEEGILPHEMSLKEKNGIEEERRLAYVGMTRAKKVLHLSFSSYRKRYTDGV
FT                   RLPSRFWDEIPQHLLRWHSRFTHKRFTGPLYGFTARPAGESRQSVHVLKDRYPRESFSI
FT                   SDSVKHSVFGVGTVVDVLGLGPKQIIVVEFADKRRSLLASIAPIVKCKQ"
     atgacaattc cggccgattt actcaagggt ttgaaccccc agcaggtgga gggtgtctgc        60
     tatagggggc caacccttct tatttccgct ggcgccggca gtggtaagac taaggtgctg       120
     acccatagga ttgccggatt tctggcaaca ggtgaagcat cctgtgacca gatattggcg       180
     attacattca caaataaggc tgcatctgaa atgcgccatc gcaccgggga tcttgttgga       240
     ttatccgtca gagatatgca gatatctacc ttccattcag tctgtgtgag aattcttcgt       300
     gaatgtgtcg ggcatctagg caaggcaaag aatttcacga tatatgatgc tgcagaccag       360
     cgtgcgatta tcaaacaaat ctgtcagtct acggatactt ttggactaac ggcaagcatg       420
     gttgcctcgc aaataggtct gttgaaaaac caaatgcata ccccagacac ctattcgcgc       480
     tgtcttgcct caaattccac taatggcaat tcggtaactt cgattacctt acagagagaa       540
     cagtttatcc tgcacgtttt taggcgctac caggagattc tgaaagaggc aaatgccttt       600
     gactttgatg atcttatttc cgaaacagtt tttttactcc agaaatcccc ggagatttct       660
     gcaatgtata gaaaccgctg gaagtatctt ttggtagacg aatatcagga tacaaaccat       720
     gcccagtata ggcttattct tgagctgaca aaaggtgata aaagcgacat gtctctgaca       780
     gctgtcggtg attcagatca gagtatatac gctttccggg gtgctgatat tgccaatata       840
     gtgaatttcg aaaacgattt tccggactgt cacacaatct tattggagca gaattaccgc       900
     tcttgccaga atattctttt agctgccaat gcgcttattt caaataatca gaatcgtaag       960
     gataaaaacc tgtggagcga actaggtgcc ggtgagaagg ttgttgcata ctgtgcatct      1020
     tccgcagaag aagaggggcg ttttgttgca gatagggtgc gccatctggt cgatcaaggt      1080
     gagagcttgt ctgatatagc ggttttttac cgatccaata ctcagagcag agcaatagaa      1140
     gaatcactca tcaggcaatc aattccatac agagttgttg gcgggacaaa attttatgaa      1200
     cgcgctgaaa taaaagatat tctggcgtat ctgacagtaa ttgtcaatcc agacgatacg      1260
     ctggctctca ggcgtattct aaatgttcca aagcgtggtg tcggaacggt atcagagaat      1320
     aggcttgttg aatttgccag tgctagaggc ataacactta tgcaggcact ttctcgcatt      1380
     gatgaaatta acattcagcc atctgccaaa tcagctcttc gggatctctt ttacttatta      1440
     aatcgctttg ccggatctag tatgccggcc aatgaactgc tcgacgacct gctaaaagct      1500
     acagaccttc taagtcgatt caacaacact gatgatcctc aaaatgaggc tagaaagatc      1560
     aatattgggg actttgtaga ttcggttgag gatttcgcaa aagaaaaccc cggaggcact      1620
     ctatctgact ttatgacaaa tattgcactt atgacatcct acgatcagtc tgatgacgca      1680
     ccgggccaga ttaccctcat gaccttacat atggcaaagg gtcttgaatt tgattttgtg      1740
     tttctaactg gtctggaaga gggtatcctt cctcacgaaa tgtctcttaa agagaagaat      1800
     ggcatagaag aagagcgtag acttgcctat gttggtatga cgcgcgcaaa aaaagttctt      1860
     cacctttctt ttagtagcta ccgaaaacga tacacagatg gggtgcgctt gccgagtcgt      1920
     ttttgggatg aaattcctca gcatctcctg cggtggcaca gtcggtttac acacaagaga      1980
     tttaccggtc ccctgtacgg gtttacagcg cgtcccgcag gggagtcacg gcaatcagtg      2040
     catgttttga aagaccgata cccccgtgag agtttttcta tttcggatag tgtaaagcat      2100
     tccgtttttg gtgttggaac ggtggttgat gttcttggtt tgggcccaaa acagataatt      2160
     gttgttgaat ttgctgataa acgccgcagt ttgctcgcga gtattgcacc cattgtaaaa      2220
     tgcaaacaat ag                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page