(data stored in ACNUC30630 zone)

EMBL: BX251410.PE88

BX251410.PE88        Location/Qualifiers
FT   CDS_pept        95602..96681
FT                   /transl_table=11
FT                   /locus_tag="TW096"
FT                   /product="putative integral membrane protein"
FT                   /note="Weakly similar to Streptomyces coelicolor putative
FT                   integral membrane transport protein SCO0079 or SCJ11.08c
FT                   SWALL:Q9RI96 (EMBL:AL109949) (407 aa) fasta scores: E():
FT                   2.3e-19, 26.37% id in 364 aa"
FT                   /protein_id="CAD66780.1"
FT                   /translation="MIPASAIKYMAEDLNVSLGKIGFLITLFSFAVILTAPILTIITRG
FT                   ISRRSLMTTVIIFLGLFHASAALFTGYEMVAVVRFLTGAVHGMFWTLVGSIVGQLYAPR
FT                   SLARAMSIVLGGGTVSYVIGLPLSNFFAFQFGWKSVVIVLGIMFVLLGLLFNFTLKVPL
FT                   HSARMGPAKNRNVFKSKWMPICILSASVLLGQFIFSSYVPAFLSKRYSPEFVSILLFVY
FT                   GFCGCIGNVLAGVFKPTRRRFMVIIATSLICILLFSFMDNAIGLAAYAIWGAMFGAVPV
FT                   LLTVFLLSNTSDNNRDIANAYYTMSFNIGIGSGALFGGLFLDGFGFYVLPLASCAALLL
FT                   SFLLSLRTVSGRHNPADTG"
     atgatccccg cttcagccat aaagtatatg gctgaagatc tgaatgttag cctcggaaaa        60
     attgggtttt tgataacatt gttttccttt gctgtaattc tgacagcccc cattcttact       120
     attattacta ggggcataag tcgcagatct cttatgacta cagtcattat ttttctgggc       180
     ctctttcatg caagcgctgc gctttttacc ggatatgaga tggtggcagt ggttcgcttt       240
     ctgacaggtg ctgttcacgg tatgttttgg acacttgtcg gaagtatagt tggccagcta       300
     tacgcgccac gcagtctcgc aagagcaatg tcgattgttc ttggaggtgg cactgtttct       360
     tatgttattg gccttccgtt gtcaaacttt tttgcatttc agtttggctg gaagtcagtg       420
     gtgattgtcc tgggtattat gtttgttcta ttgggcttgt tattcaactt tacgctgaaa       480
     gttcccctac attcggccag aatgggtcct gccaaaaata ggaatgtttt taaaagtaaa       540
     tggatgccga tttgtatttt gagcgcctca gttttacttg ggcagtttat tttttcaagt       600
     tatgttcctg cgtttttgtc aaagcgatat tcgccagagt ttgttagtat tctcctattt       660
     gtatacggat tttgtggatg tattggcaat gttctggcag gtgtttttaa acccactcgt       720
     aggcgattta tggttatcat cgctacatca ttgatttgta ttttgctttt ctcgtttatg       780
     gataacgcaa ttgggctcgc tgcgtatgct atttggggtg ccatgtttgg tgcagtcccg       840
     gtattgttga ctgtcttttt gctgagtaat acaagcgata ataatcgtga tatcgccaac       900
     gcttattaca ctatgagttt caacatcggg ataggttcgg gtgcactatt cggcgggctt       960
     tttctcgatg gatttgggtt ttatgtgctt ccacttgcgt cttgtgccgc attactgttg      1020
     agttttctgt tatcactgag aactgtttca gggcgccata atcctgctga taccggctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page