(data stored in ACNUC30630 zone)

EMBL: BX251410.PE9

BX251410.PE9         Location/Qualifiers
FT   CDS_pept        10472..11095
FT                   /transl_table=11
FT                   /locus_tag="TW009"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   protein SCO3855 or SCH69.25c SWALL:Q9XA09 (EMBL:AL079308)
FT                   (297 aa) fasta scores: E(): 9.4e-13, 40% id in 155 aa"
FT                   /protein_id="CAD66701.1"
FT                   /translation="MIIWRRLRAYPPATATIITLCIFLWLLQMLLGSGVTTSLAFAGAY
FT                   VFPDSLQPWRIFTSMFLHSTFTPLHLLFNMYSLWWLGSNLEQRIGSWRFLALYFISGLG
FT                   AAVGIVYLQPYNTLTLGASGGIFGLLAAFIVLRIDSGQLWGIVGLNLIISFLLPGVSWQ
FT                   AHIGGLLSGFVAAWAIKRRNPLLLGAQVILLIGVIATRPYLLYA"
     atgattatct ggcgaaggct tcgtgcttat cctccggcca ctgcaaccat aattactctg        60
     tgcatttttt tgtggctatt gcagatgctt ctgggttccg gtgtaaccac aagtcttgcc       120
     ttcgcggggg cgtatgtgtt tccggacagc ctgcagccgt ggaggatttt taccagcatg       180
     ttcttgcatt caacctttac accgcttcac ctcctgttca acatgtactc tctgtggtgg       240
     ttgggcagta acctggagca gcgaataggc tcatggcgct ttttggcgct ctatttcata       300
     agtggcctgg gtgccgctgt gggtattgtg tatcttcagc cttataacac cctgacactg       360
     ggggcatcgg gtggtatatt cggccttctt gcggcattta ttgtgttgcg cattgactcg       420
     ggacagttat gggggattgt cggcctgaac ttgatcattt cgtttttact tcccggggta       480
     tcctggcaag cacatatcgg gggtctttta tcaggttttg ttgcagcgtg ggccataaag       540
     cgcaggaatc cattattgct tggggcacag gtcattctgc tcattggagt aattgcaacg       600
     agaccgtacc tgctgtacgc ctaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page