(data stored in ACNUC30630 zone)

EMBL: BX251410.PE90

BX251410.PE90        Location/Qualifiers
FT   CDS_pept        97781..98905
FT                   /transl_table=11
FT                   /locus_tag="TW098"
FT                   /product="putative metalloprotease"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   zinc metalloprotease Rv2869c or mt2937 or mtv003.15C
FT                   SWALL:YS69_MYCTU (SWALL:O33351) (404 aa) fasta scores: E():
FT                   8.7e-11, 34.51% id in 423 aa"
FT                   /protein_id="CAD66782.1"
FT                   /translation="MFFLGVLIILIFVYIAVALHELGHMLPAKYFGVPVQKYAIGFGPS
FT                   LFSFKKRETSYSFNLLPLGGYVQLEGMLPPSENPRRWFKKLMKFAESDSPRAFWRLPAW
FT                   KKIIVMFSGPFVNLILATLGYVFVLSVLGLPVIKPVIHEVIANTPAASAGILPGDEIIA
FT                   INDTAISSPGQIRGLIQDKDLVTLSLLKDGGTRIVSLRPLNGSIGVKFSTVNERQSIFD
FT                   ALSSMVKDTVGVAKSLIALPYNLFTGLADTLHQRKDGVVGLIGAARISGDIVSAPSISL
FT                   YDKLRSMIWIFASLNLALFVFNMIPLLPFDGGYIAAAVFEGARSRVLLAFRKNDYAPVN
FT                   ISYLLPVTLLVTAAIIVMSIMLAWIDIVNPLRLG"
     atgttttttc ttggtgtcct gatcattctt atttttgtgt atattgcagt tgccctgcat        60
     gaacttggac acatgctacc ggcaaagtat ttcggtgtgc cggtgcagaa atatgcaatt       120
     ggatttggac catctctttt cagttttaag aagcgcgaga cttcatattc tttcaatctt       180
     ctaccattgg gtgggtatgt tcagctggag ggcatgctgc ctccatctga aaaccctcga       240
     cgttggttta aaaaacttat gaaatttgcc gaatctgata gcccacgggc gttttggcgc       300
     ctgcctgctt ggaaaaaaat aatagttatg ttttctggtc cgtttgtaaa tcttattctc       360
     gcgacattgg ggtatgtatt cgttctatct gttctgggcc tcccggttat aaaaccggtg       420
     attcacgagg ttattgcgaa cactccggct gcttctgccg gaattcttcc gggtgatgaa       480
     attattgcaa taaacgacac agcaatcagc tcaccgggtc agattagggg tctcatacaa       540
     gacaaggatc ttgttacgct atcgcttctc aaagatggcg gcacccgtat tgtttcactg       600
     cgacctttga atggttcaat tggtgtgaag ttttcgacgg tgaatgaaag gcagtcaatt       660
     tttgatgctt tgtcaagtat ggtaaaagat accgttggcg tggcaaaatc tcttatcgct       720
     ctgccatata acctgtttac gggccttgcc gatacattac atcagagaaa agatggtgtg       780
     gttggcctta ttggtgcggc tagaatctcg ggtgatattg tatccgcacc cagcatttca       840
     ttgtatgaca agttgcggag catgatctgg atttttgcct cattgaatct tgcgttattt       900
     gttttcaaca tgattcctct tttacctttt gacggtgggt atattgctgc tgctgttttt       960
     gagggcgcgc gttcacgcgt gcttcttgcg ttcagaaaaa atgactacgc tccagtcaat      1020
     atctcatatt tgttacctgt tacactgctt gtaacagccg cgattattgt gatgagtatt      1080
     atgctcgcct ggatagatat agtaaacccg cttcgtcttg gttag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page