(data stored in ACNUC30630 zone)

EMBL: BX251410.PE92

BX251410.PE92        Location/Qualifiers
FT   CDS_pept        100065..100817
FT                   /transl_table=11
FT                   /locus_tag="TW100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO3845 or SCH69.15 SWALL:Q9XA19 (EMBL:AL079308)
FT                   (515 aa) fasta scores: E(): 5.4e-22, 35.98% id in 239 aa,
FT                   and to Rhizobium loti probable phosphoprotein phosphatase
FT                   mlr2361 SWALL:Q98IK3 (EMBL:AP002999) (280 aa) fasta scores:
FT                   E(): 1.4e-20, 36.08% id in 230 aa"
FT                   /protein_id="CAD66784.1"
FT                   /translation="MSNRSTGSDDYIVSGKFSISWASLSHVGHHRESNEDSYSAKPPLW
FT                   VVADGMGGHACGDIASGVVTSFLSAISSDFVSPQDITGALRQALASLAKKIGSTTAGTT
FT                   LSGIGLSKVDNQPAWLVLNLGDSRVYCIESDKIRLLTEDHSIVHEMIKSGQITPEEAAI
FT                   HPYNNIITRAVSFNSEPIPDFSFLPLRSGVRFIICSDGLTKELNDAQIETHATRGSPRE
FT                   AAESLLYAALSAGGRDNITIILLDVHDK"
     gtgtctaata gatcaactgg ttcagatgat tacatcgtct ctggcaagtt ctctatatcg        60
     tgggcctcac ttagccatgt tggccaccac cgagagtcta atgaagacag ctacagtgca       120
     aagcccccgt tatgggttgt tgccgatggc atgggtggtc atgcttgtgg tgatattgcc       180
     agcggagttg ttacatcttt tctgtctgct atatcttcag actttgtaag tccgcaggat       240
     attactgggg ctttgcgaca agcacttgca agtcttgcca aaaaaattgg ctctaccact       300
     gcgggaacaa ccctatcggg aattggactc tcaaaagtgg ataaccaacc agcctggctt       360
     gttctaaatc tcggcgatag ccgtgtttat tgtattgaat ctgacaagat acgtttacta       420
     actgaagatc attcgattgt tcacgagatg atcaaaagcg gccaaataac accagaagaa       480
     gctgctattc atccttataa caacatcata acccgggcag ttagtttcaa cagcgaaccc       540
     attccagatt ttagctttct tccgcttcgc agcggcgtac ggtttattat ttgttctgat       600
     ggacttacca aagaattgaa tgatgcgcag atcgagacgc atgctacccg tggatctcct       660
     cgcgaggctg ctgagagtct tttatatgca gcactctctg ctgggggaag ggacaatatt       720
     acgattatcc ttcttgatgt tcacgataag taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page