(data stored in ACNUC30630 zone)

EMBL: BX251410.PE94

BX251410.PE94        Location/Qualifiers
FT   CDS_pept        102673..102936
FT                   /transl_table=11
FT                   /locus_tag="TW103"
FT                   /product="putative membrane protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66786.1"
FT                   /translation="MAACLFLAVLLTLRPILHPGFLLVPSDTIFGGLWLLTFVVGLIGV
FT                   IYFMHMLIFTPLCDKVDHMEYTANFGVLDLATSHVKYQCGRR"
     atggctgcat gtttgttcct ggcagttttg cttacgcttc ggcctatctt gcatcccgga        60
     ttcctgctcg ttccttccga tacgattttt ggtggcttgt ggcttctcac ctttgtcgtg       120
     gggcttattg gggttatcta tttcatgcat atgctcatct ttacgccgtt gtgcgacaaa       180
     gttgatcata tggaatacac tgctaacttt ggcgtacttg atctcgccac aagtcatgtc       240
     aaataccaat gtgggagaag atag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page