(data stored in ACNUC30630 zone)

EMBL: BX251410.PE95

BX251410.PE95        Location/Qualifiers
FT   CDS_pept        102921..103964
FT                   /transl_table=11
FT                   /locus_tag="TW104"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66787.1"
FT                   /translation="MWEKIADLRRSLTLSGVFFVYFTRKVFSYRLGLSSRMFILGICVL
FT                   LYGTVLIYRLSLLAPVFYDFVTLIGAAESIINLFMAFLFAKILFLRSGGLMNFTMQLPL
FT                   KNKERTMALTICEILIVFMGFTILYSPEAIVSTWKTGQPAYLLVNGLMPGFIAYILCSL
FT                   IYNLSVRIFILFNLSRLSHIGGIIVTIFAFLGLLIFVGQSVQSLLPAPGQSIKQAYDHL
FT                   QTDVFLIFNVFFWLFQHYGLLTSILAFLISLIILFPALIISIPSKYPDVHRFIKFPVPF
FT                   INSTLWPFIAVFIRRIEWWVAVVVSILSIPLGGFVLILLNLHLLALFSAGIYMFSMSRA
FT                   IRTATWI"
     atgtgggaga agatagctga tctgcgccga tcgcttactc tctctggcgt ctttttcgtt        60
     tacttcactc gcaaggtttt ctcgtatcgc cttggcctgt catcgcgtat gttcattctt       120
     ggcatatgcg tcctgctcta tgggacggtc ctaatttaca ggttgtcttt attggcccct       180
     gtgttttatg actttgtcac tcttatcggt gcagcggagt caatcatcaa cctttttatg       240
     gctttcttgt ttgcaaagat actgttcctg aggtctggcg gacttatgaa tttcaccatg       300
     caacttccct tgaaaaataa agaaaggact atggccctga caatctgcga aatactgatt       360
     gtctttatgg gattcacgat actgtattca cctgaagcaa tagtctctac ctggaaaaca       420
     ggtcagcccg cgtacctgct ggtaaatggg cttatgcctg gcttcatcgc ctatatcctt       480
     tgttctctta tatataatct ctcggttcgt atatttatcc tcttcaatct ttcccgcttg       540
     tcgcatattg gcggtatcat tgtcacaata tttgcctttc ttggcttatt gatttttgtt       600
     ggccaatctg tccagagcct actccccgcg ccgggccagt caattaagca agcctatgac       660
     catttacaga cagatgtgtt cttaattttt aacgtcttct tctggctttt tcaacactat       720
     ggcctgttga catcaatact tgcctttctt atttccctta ttatcctttt tccagccctg       780
     attatctcta tcccctcaaa gtatccagat gtacaccgtt ttataaaatt ccctgtgcca       840
     ttcattaact cgaccctatg gccgtttatt gctgttttta tccgtcgaat tgaatggtgg       900
     gtggctgttg ttgtttctat cctgtcaata cctctgggtg gttttgttct tatcttgcta       960
     aatttacatt tgcttgccct cttttctgcc ggtatctata tgttctccat gtctcgcgcc      1020
     ataaggactg ctacctggat atag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page