(data stored in ACNUC30630 zone)

EMBL: BX251410.PE96

BX251410.PE96        Location/Qualifiers
FT   CDS_pept        103993..104355
FT                   /transl_table=11
FT                   /locus_tag="TW105"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66788.1"
FT                   /translation="MFAAQALCICPFLMLVQLALYIASFASGTIVPHDPINLSVILMFG
FT                   VILPTFIGILFVHNEDNPVQAFAGYFVVSIIAMVTYLAISVTGQIFLLILFTEAIVAIP
FT                   LTILAVQAVRKSERYA"
     atgtttgcag cccaagcact atgtatatgc ccgtttctta tgctggttca gcttgcacta        60
     tatattgcct cttttgcttc gggcactatc gtcccgcatg acccaataaa cctatctgtt       120
     atcttgatgt ttggcgtaat acttccgaca tttatcggca tcctatttgt tcataacgaa       180
     gataatcccg ttcaggcctt tgccggctac tttgtcgtca gtattattgc catggttacg       240
     tatcttgcaa tatccgtcac tggccaaata ttccttttga ttctctttac agaggctatt       300
     gttgccattc ccctgactat ccttgctgtt caggcggtta gaaaaagcga gcgttacgca       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page