(data stored in ACNUC30630 zone)

EMBL: BX251410.PE97

BX251410.PE97        Location/Qualifiers
FT   CDS_pept        104352..105071
FT                   /transl_table=11
FT                   /locus_tag="TW106"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /note="Similar to Myxococcus xanthus PilH SWALL:O30385
FT                   (EMBL:AF003632) (326 aa) fasta scores: E(): 1.1e-12, 33.49%
FT                   id in 206 aa, and to Streptomyces coelicolor putative ABC
FT                   transporter ATP-binding protein SCO3633 or SCH10.11
FT                   SWALL:Q9X8Q0 (EMBL:AL049754) (311 aa) fasta scores: E():
FT                   2.3e-11, 29.61% id in 233 aa"
FT                   /protein_id="CAD66789.1"
FT                   /translation="MNILSVQDVSFSYDKSTPAIYGVDLQIDPGEVVGLVGPNGSGKST
FT                   FIKLVFDLLELQKGQIQILGNNHRLTTARLASIYLPSDDDLPEFLTGDEYLRTLFRLYK
FT                   RPFDKNSVLREFDRFGMRGRERNLIEDYSHGMRKKLQLISAFLLQLPLTVIDETINGID
FT                   LDAVYECRKSITELKSRGHSVLLCTHDFYFLQKVADKVIVFHQAKQIASFATPSHEHLE
FT                   DRVAEILGVDLHDRGAL"
     atgaatattc tttccgtcca agatgtttcg ttttcatatg ataaatccac accagctatc        60
     tatggcgttg atcttcagat tgatcccggc gaggtggttg gcctggttgg ccctaacggg       120
     tcaggtaagt caacatttat aaaacttgtt tttgacctcc ttgaattgca aaaagggcag       180
     atacagatcc tgggcaataa tcaccgtctc acgactgccc gtcttgcatc tatatacctg       240
     ccgagcgatg atgaccttcc agaatttcta accggcgatg aatacctgcg aacactcttt       300
     aggctctata aacgaccttt tgataaaaac agtgtattgc gtgaatttga ccgcttcggc       360
     atgcgaggtc gtgagcgtaa tttaatagag gattattccc acggcatgcg caaaaagcta       420
     cagctgatta gtgcatttct gctgcaactt cccctgactg ttatagatga gacaataaat       480
     ggaattgatc ttgatgccgt gtatgagtgt cgtaaatcca ttacggaact aaagtctcgc       540
     ggacactctg ttttactctg cacccatgac ttttattttt tgcaaaaagt ggccgataaa       600
     gtcatcgtat tccatcaggc caaacaaatt gccagctttg ccacaccgtc acacgaacac       660
     ctggaggatc gcgtggcaga aatactggga gtagatctgc atgatagggg agcgctgtga       720
//

If you have problems or comments...

PBIL Back to PBIL home page