(data stored in ACNUC30630 zone)

EMBL: BX251410.PE98

BX251410.PE98        Location/Qualifiers
FT   CDS_pept        105068..105424
FT                   /transl_table=11
FT                   /locus_tag="TW107"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66790.1"
FT                   /translation="MTQAFSRRSPFRKIKLVTAILSSSFALSMITVFVSFMYLVAITDP
FT                   SSGVEQYHSLIFNTIYIRTEPSSKGVHIDISVGLLAVILPFLFFTIIISLCVFFYKKFI
FT                   KNKKTTKSKKLPLK"
     gtgactcagg catttagcag aaggtcaccg tttcgcaaaa taaaacttgt cacggcaata        60
     ctctcatcca gttttgctct atcaatgatt accgtttttg tttcttttat gtacctcgtt       120
     gcaattactg acccgtctag cggtgttgag caatatcact cacttatttt taacaccatc       180
     tatattcgta ccgaacccag cagtaaaggt gttcatatcg atatatctgt tggccttctt       240
     gcggttatcc tgccattcct attcttcacg atcataatct ctctgtgtgt atttttttac       300
     aagaagttta taaaaaacaa aaagacaact aaatcaaaaa aattaccttt gaaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page