(data stored in ACNUC30630 zone)

EMBL: BX251410.PUNA

BX251410.PUNA        Location/Qualifiers
FT   CDS_pept        complement(18061..18894)
FT                   /transl_table=11
FT                   /gene="punA"
FT                   /locus_tag="TW018"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="Similar to Cellulomonas sp purine nucleoside
FT                   phosphorylase PunA SWALL:PUNA_CELSP (SWALL:P81989) (282 aa)
FT                   fasta scores: E(): 6.6e-45, 48.33% id in 271 aa"
FT                   /protein_id="CAD66710.1"
FT                   /translation="MEDICNTELTAATLAAKQIADITGIARHDIAVTLGSGWVDAVSNL
FT                   GELITTIPAQDIHGFFPPVLAGHSGVLTSIRLTCGVYVLVIGARTHLYQGHGPEAVVHG
FT                   IKTAHAAGARVAILTNGAGSTVPDWGPGEVVVIKDHINLTGKSPLSGANFCDMSDIYTA
FT                   ALRQKILQMAPNIPQGVYAQMPGPQYETPAEVKMLRTIGADLVGMSTALEAIMAKSLKM
FT                   NVVGLSLVTNLAAGIGTGQLSHDEVLTVSEQARQKTSAFLVELIRDIGQDLSGRK"
     atggaagata tctgcaatac tgaactcacc gctgctacat tagctgcaaa acagattgca        60
     gatataacag gtattgcccg gcatgacatc gccgttactt tgggtagcgg ctgggttgat       120
     gctgtatcca acctcggtga gcttattaca acaatccccg cgcaagatat acacgggttt       180
     ttccctcccg ttttggctgg ccacagcggt gttctgacct ccattcgact tacgtgcgga       240
     gtatatgttc ttgtaatagg cgcgaggact catctctacc aaggacatgg ccctgaggct       300
     gtggtgcatg gcatcaaaac cgcccatgca gcgggggcga gggtggcaat ccttaccaat       360
     ggcgcgggaa gcacagtgcc tgattggggt cctggagagg tggtagtaat aaaggaccat       420
     atcaatctga ccggaaaatc tcctctaagc ggggcaaatt tttgcgatat gagcgatatt       480
     tatacggccg cactcaggca aaaaatcctg caaatggccc ccaatatccc tcaaggggtg       540
     tacgcgcaaa tgccgggtcc tcagtacgaa acaccggctg aggtgaaaat gttgagaact       600
     atcggcgcag atcttgtcgg aatgtcgaca gcccttgagg caataatggc aaagtcacta       660
     aagatgaatg ttgtggggtt gtctcttgtg acaaaccttg cggcgggaat aggtacagga       720
     caattgagcc atgatgaagt gctgactgta agcgaacagg ctagacaaaa aacttcagca       780
     tttctcgtag agctcattcg tgacatcggg caagatctat cgggcaggaa ataa             834
//

If you have problems or comments...

PBIL Back to PBIL home page