(data stored in ACNUC30630 zone)

EMBL: BX251410.PURC

BX251410.PURC        Location/Qualifiers
FT   CDS_pept        complement(126672..127589)
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="TW119"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="Similar to Streptomyces coelicolor
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   PurC or SCO4071 or SCD25.07 SWALL:Q9RKL1 (EMBL:AL118514)
FT                   (299 aa) fasta scores: E(): 1e-38, 40.64% id in 310 aa, and
FT                   to Mycobacterium tuberculosis
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   PurC or Rv0780 or mt0804 or mtcy369.24 SWALL:PUR7_MYCTU
FT                   (SWALL:Q59566) (297 aa) fasta scores: E(): 1.6e-28, 38.19%
FT                   id in 288 aa"
FT                   /db_xref="GOA:Q83IB9"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IB9"
FT                   /protein_id="CAD66801.1"
FT                   /translation="MTRKLEIPESRDLPDWSHIGGGKVRELYVHRQYKNILLMFASNRV
FT                   SAFDFVLEPEIPEKGRMLTQMSNWWFRKLPAENHLLENYDQELYRDLASHIPSHILERS
FT                   TICRKMDIIPFEFVIRGYLTGSAWADYLENNTVYGIKLKGKFRQGDRLPGPIFTPTTKS
FT                   RTKDTPVRYEDLVNAIGLSHAQQLREMCTDYYTTAEQIARNKGLIIADAKFEFGIAEGK
FT                   AYLADELLTADSARYWDINSWGQFDLPIERRLDSFDKQAVRDWVKCNSGKNITPQNITP
FT                   LRLPQELIQTVYKKYKTLLAKLTG"
     atgacaagaa aacttgaaat accagaatcg cgcgacctgc cagattggtc tcatataggc        60
     ggaggaaagg tccgtgagct ttatgtccat agacaataca agaacatcct cctaatgttt       120
     gcatcaaacc gggtaagcgc atttgacttt gtcttagagc ccgaaattcc cgaaaagggg       180
     cgcatgctga cacaaatgag caattggtgg ttccgtaaac tgcctgccga aaatcatctt       240
     ctggaaaatt acgaccaaga attatataga gaccttgcaa gccacattcc aagccacatt       300
     ctagaaaggt caacaatatg caggaaaatg gatatcatcc catttgaatt cgttataagg       360
     ggttacttaa ctggctcagc atgggcagat tatctcgaaa acaacacggt ttacgggatc       420
     aagctaaagg gaaaatttcg ccagggtgat aggctccccg ggccaatttt taccccaacg       480
     acaaaaagta gaacaaagga tacgcccgtt cgctatgaag atcttgtaaa tgcaatcggt       540
     ttgagccatg cgcagcaact tagagagatg tgcacggact attacacaac cgctgaacag       600
     atagcacgca acaagggtct tattattgca gacgcaaagt ttgagtttgg catagctgaa       660
     gggaaagcgt atcttgctga cgagctgcta acagctgatt cggcaagata ttgggatatc       720
     aattcatggg ggcagtttga tttgcccata gaacgcagat tggatagctt tgacaagcaa       780
     gctgtgcgcg attgggtaaa gtgcaattct ggcaaaaaca taaccccaca aaacataacc       840
     ccactgagac ttccacagga acttattcaa actgtttata aaaagtacaa aacattacta       900
     gctaagctaa cgggatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page