(data stored in ACNUC30630 zone)

EMBL: BX251410.PURE

BX251410.PURE        Location/Qualifiers
FT   CDS_pept        28311..28853
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="TW029"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit PurE"
FT                   /EC_number="4.1.1.21"
FT                   /note="Similar to Corynebacterium ammoniagenes
FT                   phosphoribosylaminoimidazole carboxylase catalytic subunit
FT                   PurE SWALL:PUR6_CORAM (SWALL:Q44679) (177 aa) fasta scores:
FT                   E(): 7.7e-28, 55.09% id in 167 aa, and to Streptomyces
FT                   coelicolor phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit PurE or SCO3059 or SCBAC19G2.14c
FT                   SWALL:Q93J44 (EMBL:AL596138) (180 aa) fasta scores: E():
FT                   3.7e-27, 54.21% id in 166 aa"
FT                   /protein_id="CAD66721.1"
FT                   /translation="MTGKNINDEGSKCPALVWLLMGSDSDWPVMSGAADILQQMNISFR
FT                   VNVVSAHRQPEKMISCAKRARDMGFKVLIAAAGGAAHLPGMLASVTTLPVIGVPVGQKN
FT                   LSGLDSLLSIVQMPSGVPVACVGIDSAKNAALLAARILGVQSADIEASRIADSLSAYQQ
FT                   SLFDQSNEKDRMINEPK"
     atgactggta aaaacatcaa cgatgaaggt agcaaatgcc ccgctcttgt ttggctccta        60
     atgggttctg attcggattg gcccgttatg tcaggcgccg cagatatcct gcagcagatg       120
     aatatatctt tcagagtaaa tgttgtttct gcccatcgcc agccggaaaa gatgattagc       180
     tgcgccaaac gcgctcgtga catgggattc aaagttctga tagctgctgc cggtggagcc       240
     gcacacttgc ccggaatgct tgcaagtgtc acaactctcc ctgttatcgg agttccggtt       300
     gggcagaaaa atctgtcagg cctcgattct cttttatcga ttgttcaaat gccctctggt       360
     gttccggtgg cctgtgtcgg catagattct gctaaaaacg ctgcccttct ggccgcaagg       420
     attttggggg ttcaatcagc cgacatagaa gcatccagaa tagcagatag tttgtctgca       480
     tatcagcaaa gcctgtttga tcaatcaaat gaaaaggaca gaatgataaa tgagccgaaa       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page