(data stored in ACNUC30630 zone)

EMBL: BX251410.PURH

BX251410.PURH        Location/Qualifiers
FT   CDS_pept        93477..95105
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="TW094"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /note="Similar to Mycobacterium paratuberculosis PurH
FT                   SWALL:Q9RAJ5 (EMBL:AF191543) (527 aa) fasta scores: E():
FT                   8.2e-59, 50.46% id in 543 aa, and to Escherichia coli
FT                   bifunctional purine biosynthesis protein PurH [includes:
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase
FT                   purh or b4006 SWALL:PUR9_ECOLI (SWALL:P15639) (529 aa)
FT                   fasta scores: E(): 2.6e-27, 39.48% id in 547 aa"
FT                   /protein_id="CAD66778.1"
FT                   /translation="MTTNIRIKRALISVSDKSGLADLAEALAAHSVKIVSTGSTAEFIR
FT                   GVSIPVRDVSEVTGVGELLDGRVKTLHPKIHAPILADTTSQMHRAQLQQLGVDAFDLVV
FT                   VNLYPFFEISKNSEAEFSDVIEQIDIGGSALIRAAAKNHTRVVVIVDPSDYIHVINSLE
FT                   RGAPSRLRHQLAIKAYSHTSEYDLHISRWLSERFYKHTLYSSSDSVGDVCDNNLDSNDH
FT                   FVELRGKKLGDLRYGENSHQKASLYLSCKESVPQLGLASAALLGGKQMSYNNYLDADVA
FT                   SRIVNSFDLPTVSFVKHGNPCGIASNIEVAIACRNAHECDPTSAFGGVVAVNREVTLDV
FT                   ATHLLPIFIEVVVAPGYDPQALQLLLKKKNLRVVELPECASYPQDQLRQISGGFLVQDA
FT                   DKFDHHDTFSSWTQVSGPRIFMDAGADNETLMDLEFAWKSCAFVKSNAILLAKNMASVG
FT                   IGMGQVNRLDACYLAVNRAGSRSLGAVAASDAFFPFSDGLDVLINSGVKAIVQPGGSVR
FT                   DNAVIAAAQQAGVTMFFTGKRHFAH"
     atgacgacaa atatacgtat aaaaagagct cttatttcag tgagtgataa gtcaggcctt        60
     gcagatctag cagaagccct cgcggcgcat tctgtcaaaa tagtgtcaac cggcagcacg       120
     gcagagttca tacgcggggt gtctattccc gtgcgcgatg tatctgaggt aacaggggtt       180
     ggggaactct tggatggccg cgtgaaaacc ctgcatccca aaatacatgc cccgattctt       240
     gctgacacaa cttcacagat gcaccgcgcg cagctacagc agcttggcgt tgatgctttt       300
     gatcttgtcg tggtcaacct gtatccattt tttgaaattt ccaaaaactc tgaagcagaa       360
     ttctctgatg taattgagca aattgacatt ggtggctctg ccctaataag ggctgcggca       420
     aaaaatcata cacgagttgt tgttattgtt gatccaagtg actacattca tgtgattaac       480
     agccttgaaa ggggtgcccc gtcccgcctg cgccaccaac tcgctataaa ggcgtattca       540
     cacacttccg aatatgatct tcatatttcc agatggcttt ccgagcggtt ttacaaacat       600
     actctttatt cttcgagtga ttctgtaggt gatgtttgtg ataacaatct cgattccaat       660
     gatcattttg ttgaactgcg tggcaaaaaa ctgggtgatc tgcgctacgg cgaaaacagt       720
     catcagaagg cttccctata cctgtcttgc aaggagagcg ttccccaatt gggcttggcg       780
     agtgcagctc ttcttggggg caagcagatg tcgtacaaca attatcttga cgcagatgtt       840
     gcctcaagaa ttgtcaacag ctttgatctg ccaacagtat cgtttgtaaa gcacggtaac       900
     ccttgtggaa ttgcctcaaa tattgaggtt gctattgcat gcagaaatgc tcatgagtgt       960
     gacccaactt cagcctttgg cggtgttgtc gctgtcaata gggaagttac ccttgacgtt      1020
     gcaactcatc ttttgccgat ttttatagag gtagttgtgg cgcccggtta tgacccacaa      1080
     gcactacagc ttttgctaaa aaagaagaat ctgagggttg tagagcttcc tgagtgcgct      1140
     tcgtatccgc aagatcagtt gcggcaaatc tccggtggat ttctggtgca ggacgcagac      1200
     aaatttgacc atcacgacac attttccagc tggactcagg tgtctggccc acgtattttt      1260
     atggatgccg gagctgataa cgagacgcta atggatttgg aatttgcctg gaaatcctgt      1320
     gcgtttgtta aatccaatgc gattcttctg gcaaaaaaca tggcatcggt tggaatagga      1380
     atggggcagg taaatagact agatgcgtgt tacctggctg taaatcgtgc gggatccaga      1440
     tccctgggtg cagtcgccgc atctgatgca ttttttccct tttctgatgg cctggatgtg      1500
     ctaataaatt ccggagtaaa ggctattgtg cagccgggcg ggtctgttcg tgataatgct      1560
     gttatagctg ctgctcaaca ggcgggtgtc accatgtttt ttaccggcaa gaggcatttt      1620
     gcgcattga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page