(data stored in ACNUC30630 zone)

EMBL: BX251410.PURK

BX251410.PURK        Location/Qualifiers
FT   CDS_pept        26979..28232
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="TW028"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit PurK"
FT                   /EC_number="4.1.1.21"
FT                   /note="Similar to Mycobacterium tuberculosis
FT                   phosphoribosylaminoimidazole carboxylase ATPase subunit
FT                   PurK or Rv3276c or mt3376 or mtcy71.16C SWALL:PURK_MYCTU
FT                   (SWALL:P96881) (429 aa) fasta scores: E(): 1.3e-21, 39.43%
FT                   id in 421 aa, and to Schizosaccharomyces pombe
FT                   phosphoribosylaminoimidazole carboxylase Ade6 or Min1 or
FT                   Spcc1322.13 SWALL:PUR6_SCHPO (SWALL:P15567) (552 aa) fasta
FT                   scores: E(): 1.5e-14, 32.15% id in 395 aa"
FT                   /protein_id="CAD66720.1"
FT                   /translation="MLSIARIASPAQYNLRLMFERLSCSVGVIGGGQLARMMIAPAQAL
FT                   GVDLKVFADTPDSSAALAATAFGSPENGAAVLEFAQTVDIVTFEHELVPADVLQLLDER
FT                   GIEMLPCPRALRYAQDKLALRRYLDEISVNQPAWAEVRSEGDLERFISEHGGCAVVKTG
FT                   GYDGRGVQVVTLSSEIDTCRNGGFLAEERIDFVCEVSQLVARSSIGEICVWPLTQTIQE
FT                   NGICVQTITPALGLSGGNALNQLTTFHDGRTRTPHAPLHSELITKLQDSAKTIALDIAR
FT                   GLNVVGVMAVEMFITQDGKLLVNELAMRPHNSGHWSMAASITDQFEQHLRAVLGLPLGA
FT                   TDMSHNCAIMVNIFNSISPAQYREVMTHWPDAKLHIYKKQPRPGRKIGHVVFAGEDLQQ
FT                   LAIAAEECRQLLRESHAV"
     atgttatcta ttgcacgcat tgcttctcct gcacagtata accttagatt gatgttcgag        60
     agattgagtt gttcggttgg tgtgattggt ggaggtcaac ttgccagaat gatgattgcc       120
     cctgcgcagg ctctcggggt tgatttaaag gtctttgcag atacccctga cagttcagca       180
     gcccttgccg caacggcttt tggcagtcct gaaaatggtg cggcagtcct cgaatttgca       240
     cagacagttg atattgtgac ttttgagcac gagcttgtcc cggctgatgt tctgcaactc       300
     ttggatgaga ggggtattga gatgctgcct tgcccgcgcg ccttgcggta tgctcaagat       360
     aaattggcat tgcgacgcta tctcgatgag atttcagtaa atcagcctgc ctgggccgag       420
     gtacgctcgg aaggggattt agaacgtttt atttctgaac atggtggttg tgctgttgta       480
     aaaaccggag ggtatgacgg acggggtgtc caggttgtca cgctgagctc tgagattgat       540
     acttgccgca acggaggttt tcttgccgag gaaagaattg attttgtctg cgaagtatct       600
     caattagttg cccgctcatc catcggcgaa atctgcgtat ggccgcttac acaaacaatt       660
     caggagaacg gcatatgtgt tcagacgata acgccagcac ttggcctatc gggcgggaat       720
     gcgctaaatc aactcaccac ctttcacgat ggcagaacac gcaccccaca cgcgccgtta       780
     cactctgaat tgattactaa actccaggat tcagcaaaaa caatcgccct tgatattgcg       840
     agaggtttaa atgttgttgg cgttatggct gttgaaatgt tcattacgca ggacggcaag       900
     ctccttgtga acgaacttgc aatgcggcca cataacagcg ggcattggag catggccgca       960
     tcgattacag accagtttga acaacacctg cgtgccgtac tcggcttgcc gttgggtgca      1020
     actgatatgt ctcacaactg cgccataatg gtgaatatat tcaattcaat ttcgcccgct      1080
     caatatagag aggttatgac gcattggcca gacgcgaagc ttcatatata caagaaacag      1140
     ccaaggccgg gtcgcaaaat cggtcatgtt gtttttgctg gtgaagattt acaacagctt      1200
     gccattgcag ctgaagaatg caggcaattg ctgagagagt cacatgcggt gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page