(data stored in ACNUC30630 zone)

EMBL: BX251410.PURN

BX251410.PURN        Location/Qualifiers
FT   CDS_pept        92799..93437
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="TW093"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Similar to Mycobacterium paratuberculosis PurN
FT                   SWALL:Q9RAJ6 (EMBL:AF191543) (209 aa) fasta scores: E():
FT                   1.5e-21, 42.39% id in 184 aa and to Escherichia coli
FT                   phosphoribosylglycinamide formyltransferase PurN or b2500
FT                   SWALL:PUR3_ECOLI (SWALL:P08179) (212 aa) fasta scores: E():
FT                   2.1e-17, 36.2% id in 174 aa"
FT                   /protein_id="CAD66777.1"
FT                   /translation="MKTAMRLIVMVSGIGSGLLRLIRACEQKELKAEIVAVGSDRHAPA
FT                   LSHASDYGIPFFVSPFKEYSNRDAWGANLLNTVLAYKPDLVVLSGFMRILPSCVVDALS
FT                   PNLINTHPSYLPEFPGMNAVEDALRAGVKTTGASVIRVDNGIDTGPVISQMRVKVYSSD
FT                   TCQTLHSRIKKVEHLLLCRAIKNIYTEQFILKNLLHNSVRRPSGKTGDR"
     atgaaaactg ctatgagact tattgttatg gtatccggga ttggctcagg tctcttgcgt        60
     ctaattcgag cttgcgaaca aaaggagctc aaagctgaga ttgttgccgt tggctctgac       120
     aggcatgctc cagcactttc gcatgcctca gattatggaa ttccattttt tgtatcccca       180
     ttcaaagaat attccaatcg tgacgcatgg ggggcgaatc tactaaacac cgtcttggct       240
     tacaagcctg atctggtcgt gttgagcgga tttatgcgta ttctgccatc atgtgttgtt       300
     gatgctctgt cacctaattt gatcaacaca catccatcgt atttacctga gtttcccgga       360
     atgaatgccg tcgaggatgc gttgcgggcc ggtgtaaaaa caaccggtgc aagtgttatc       420
     agggtggaca atggaattga cacgggccct gttatatctc agatgagggt taaagtctat       480
     tcctctgaca catgtcagac tttacatagt cgcataaaaa aggttgagca tctgctttta       540
     tgtcgggcta tcaaaaatat atacaccgag caattcattc taaagaatct tttgcataac       600
     agcgtgaggc gtccctctgg taaaacagga gatcgatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page