(data stored in ACNUC30630 zone)

EMBL: BX251410.RECF

BX251410.RECF        Location/Qualifiers
FT   CDS_pept        2890..3981
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="TW003"
FT                   /product="DNA replication and repair protein recF"
FT                   /note="Similar to Streptomyces coelicolor DNA replication
FT                   and repair protein RecF or SCO3876 or SCH18.13c
FT                   SWALL:RECF_STRCO (SWALL:P36176) (373 aa) fasta scores: E():
FT                   3.9e-24, 37.16% id in 374 aa"
FT                   /db_xref="GOA:Q83NZ4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NZ4"
FT                   /protein_id="CAD66695.1"
FT                   /translation="MQNNLISHINLRNFRNYEYQSISFTDGLNLIRGDNGQGKTNLAEA
FT                   IYFLSGFGSHRTYKNQPLIKSGEQKAEISAKIQSKYGTRNVYIGISCNSNNILKVDGKP
FT                   SKLRDLVSVFSCVIFSPEDIDLVKGDPGHRRKYLDDIICRARPMMLDIYSAYDRTLKQR
FT                   NSLLKSFRKSSCKSDLLDIWTQKLVELGLEIVNARKRLLKILNPKISEFYSKLAGVSST
FT                   AELFCQSSDCLIDTFDLLRDREIEEGVTLAGPHRDNVDILLNSCPARSQSSQGESWTLA
FT                   LSMKLSLIELMRETKRLYDPDPVVILDDVFAHLDSYRKQKLAQEVFSYEQTIVTTTDNS
FT                   DNYRTSQTLVVEEGKVFSENKKG"
     ttgcaaaata atttgatttc tcatataaac ctaaggaatt ttcgaaatta tgagtaccaa        60
     agtatttcat ttactgatgg tctcaacctt ataaggggtg ataatggcca gggaaagacc       120
     aaccttgctg aggcaatcta ttttctgtcg ggtttcggat ctcacaggac atacaaaaac       180
     cagcctctta taaaatcggg agaacagaaa gcagagatat ctgcaaaaat tcagtctaaa       240
     tacggaaccc gaaatgtata cattggtata tcttgcaatt cgaataacat cctaaaagta       300
     gacggtaagc cttcgaaact cagggacctt gtttctgtct ttagctgtgt aatattctcc       360
     ccagaggata tagatctagt aaagggagat cccggacaca gaagaaaata tctggatgat       420
     attatctgca gggctcgccc catgatgctg gacatttatt ctgcatatga cagaacatta       480
     aagcagagaa actctctgtt aaagagcttt agaaaatcat catgcaaaag cgacctcctg       540
     gatatttgga cacagaagtt ggtggagctt ggcctggaaa tagtaaatgc tcgaaaaaga       600
     ttactaaaga ttttaaatcc aaaaattagc gaattttatt caaaacttgc gggggtgagt       660
     agcacagctg aattattctg ccaatcttca gattgcctta tagatacatt cgatctattg       720
     agagacagag aaatagaaga aggtgtaacc cttgctggac cacatagaga taacgttgat       780
     attctcttaa attcttgtcc ggcaagaagt caatcaagcc agggagaatc atggaccctt       840
     gcgctgtcta tgaaactttc ccttatagag cttatgaggg aaactaaaag actttacgac       900
     ccagatcctg ttgtgatact cgatgatgtc tttgctcatc ttgattcata tcgaaaacaa       960
     aaactcgcac aggaagtgtt tagctatgaa cagacgattg taacaacaac cgataattcc      1020
     gataattaca gaacatctca aacccttgtg gtagaagagg gaaaagtgtt cagcgaaaac      1080
     aaaaaggggt aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page