(data stored in ACNUC30630 zone)

EMBL: BX251410.RECG

BX251410.RECG        Location/Qualifiers
FT   CDS_pept        232840..234861
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="TW195"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Staphylococcus aureus ATP-dependent DNA
FT                   helicase RecG SWALL:RECG_STAAU (SWALL:O50581) (686 aa)
FT                   fasta scores: E(): 3.9e-62, 32.43% id in 666 aa"
FT                   /protein_id="CAD66872.1"
FT                   /translation="MASLLAKEFGISRVIDLLTYYPRRYICRGKLTKLSELIPGDEVTI
FT                   VGRVLSTEQRKTFSGANFLSVTLSDGENIIQLVFFHQPWRAENLKPGACGLFSGKVTEF
FT                   NNKKQLSHPEYELFSSEPTREQIQKWNEQIIPIYRACIACPSWKIARAVDLALEAVKGQ
FT                   TVDFMSGNYGYMSVEKAFYVIHHPTDNEELEAAKESLRFFEAFLLQSALLHRKRFRNRA
FT                   SATPFIRKNGGFLERFDARLEFSQTNDQLRAADEIFEDLSLSEPMTRLLHGEVGSGKTL
FT                   VAIRAMLLAADNDMQAVLVAPTEVLAKQHHRNLTRMLGHELCAEIQPSLLLGREKHTLR
FT                   IASGRSKIIIGTHSVFSKKTVFHNLALVVIDEQHRFGVGQRDELLLKGDSPHLLMLSAT
FT                   PIPRTVALSLLNFIAISEIKTPPSGKAEISTHVVPLAEKPQWGREVIRRISEEIQKGHQ
FT                   VFVVAPVIEQSRTGAASISALLRELEETPLLQGAKISRLHGKLTAAECEKSMEEFSCGA
FT                   SDILLSTTMIEVGIDVPNATAMVIVSADRFGIAQLHQLRGRIGRGNLPGVCLLVTNAPE
FT                   GSAARSRLDLVARTHDGFSLAEIDMKMRREGDLLGLGQSGQGNYRLLRLDEDLQVLSDA
FT                   RLHAEGIMENDIKLEKNKLLRLFLSQYLSGTNLSRLLS"
     atggcatcac tattagccaa agagtttggt attagtcggg tgatagacct gctcacatat        60
     taccctcgaa ggtacatctg caggggtaag cttactaagc tttcagagct aattcccgga       120
     gacgaggtta cgattgttgg ccgggttcta agcaccgagc agcgtaagac attcagtgga       180
     gcgaattttc tcagcgttac gctcagtgat ggagagaata tcattcaact tgttttcttt       240
     caccaaccct ggcgcgcaga aaacttgaaa cccggtgcat gtgggctatt ttcgggaaag       300
     gtaacagagt tcaataacaa gaagcaactc tcacatcccg aatatgaatt attttcatca       360
     gagccaacaa gggaacagat acagaagtgg aatgagcaga taataccgat ttatcgcgct       420
     tgcatcgcgt gtccaagctg gaaaatagcc cgggctgttg atttggcttt agaagcggta       480
     aagggccaaa ctgtagattt tatgtcgggt aattatggct atatgtcagt tgaaaaggcg       540
     ttttatgtta ttcatcatcc tacggacaac gaagagcttg aggccgcaaa agaaagtttg       600
     cgcttttttg aggcattttt gttacaaagc gcccttctac accgaaagcg gttccgcaat       660
     agagcaagcg caacaccttt tattcgtaaa aatggcggtt ttttagagag atttgatgcg       720
     aggctggagt tttctcagac taatgatcag ttgcgcgctg cagatgaaat tttcgaagac       780
     ttgtcgctgt cagagccaat gacccgtctc ttacatggtg aggtcggtag cggaaaaact       840
     ctggttgcga taagagctat gctccttgcg gcagataacg acatgcaggc cgtcctcgtt       900
     gcgcctaccg aagttcttgc aaaacagcat cacaggaatt taactcgcat gctgggccac       960
     gagctatgtg ccgagataca gccatctctc ttgcttggta gggaaaaaca caccttgcgt      1020
     attgcctcag gcagaagcaa gatcattata ggaacacatt cggtctttag taaaaaaacc      1080
     gtatttcata atctcgccct tgttgttatc gatgagcagc accgctttgg cgttggccag      1140
     cgggacgaat tacttttgaa aggggattca cctcatttgc ttatgctgtc tgcaacacca      1200
     attccacgaa cagttgccct ttctctgctg aattttatag caataagcga gataaagaca      1260
     ccaccaagcg gtaaggctga aatttcgacg catgttgtac cccttgcaga aaagcctcaa      1320
     tggggaaggg aggttataag gaggatttcc gaggaaatac aaaaaggtca ccaggttttt      1380
     gttgttgcgc ccgttataga acaaagccgt acgggcgcgg ccagcataag tgccttgcta      1440
     agggagcttg aggaaacccc tctccttcaa ggcgcgaaga tctcccgact gcatggcaag      1500
     ttgaccgctg cggagtgcga gaagtctatg gaagagttct cttgcggggc cagcgatatt      1560
     ctgctctcaa caaccatgat tgaggtgggt atagatgttc caaatgccac ggcaatggtt      1620
     attgtgtcag ccgatcgctt tggtatcgct cagttgcacc agttgcgcgg acggatcggt      1680
     cgaggtaatt tgcccggcgt gtgtcttctt gttactaatg cccccgaggg ctcggcggcg      1740
     cgctctaggt tggatttagt tgcaagaaca catgacggat tttctcttgc ggaaatcgat      1800
     atgaaaatga ggagagaggg agatttgctc ggcctgggtc aatctgggca gggtaattat      1860
     cgccttttac gccttgatga ggacctgcag gttttatcgg acgcccgatt acacgcggag      1920
     ggaataatgg agaatgacat aaaactcgag aagaataagc ttcttcgatt gtttttgtct      1980
     caatatttgt cgggcactaa tttgagtcga ttgctttcat aa                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page