(data stored in ACNUC30630 zone)

EMBL: BX251410.RIBF

BX251410.RIBF        Location/Qualifiers
FT   CDS_pept        221811..222749
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="TW180"
FT                   /product="riboflavin biosynthesis protein RibF [includes:
FT                   riboflavin kinase]"
FT                   /EC_number="2.7.1.26"
FT                   /note="Similar to Escherichia coli riboflavin biosynthesis
FT                   protein RibF [includes: riboflavin kinase] or b0025 or
FT                   z0029 or ecs0028 SWALL:RIBF_ECOLI (SWALL:P08391) (313 aa)
FT                   fasta scores: E(): 8.3e-30, 35.33% id in 317 aa"
FT                   /protein_id="CAD66859.1"
FT                   /translation="MRVFRSFDCLGRDKRTALTIGKFDGVHLGHRRLLERIVALQNQDT
FT                   SALVVTFDRDPKTFFKKDMSFVPLCSLEQKLSLLENCNIPNCLILRFDDEFASMSAEDF
FT                   VHKVLLEKLNMSSIVIGDGFRFGARGLGDAMLLEKLARELGFYLEVIPKIQFGKTNISS
FT                   TLIRKFLSLGQAGNASSCLGRNHVCTGTVVHGKKRGRELGFPTANLGKDVSGFIPADGV
FT                   YIGRIISDRSYPAAVSIGRNPTFGDLEFSQIEAHALYEDISSLDLYGRRIDVEFIAHLR
FT                   DTMLYKSIDSLKAAIRSDVERCKEYFSTTVG"
     gtgagggtct ttagaagttt tgattgcctt gggcgggata agcgtaccgc tttaacgata        60
     gggaaatttg atggagttca tctcggccac aggcgtttgt tggaaagaat cgtagcatta       120
     cagaatcagg acacatctgc gcttgtagta acttttgatc gtgatccaaa aactttcttt       180
     aaaaaagaca tgtcctttgt gcccctctgc agtttggagc agaagctttc tcttttagag       240
     aattgcaata ttcctaactg tcttattctt agatttgatg atgagtttgc gtcaatgtcg       300
     gctgaagatt ttgtacataa agttttgctt gagaaattga atatgtcttc gatcgttatt       360
     ggagatgggt ttcgttttgg cgctcgtggg cttggtgatg cgatgctttt ggagaaactt       420
     gcgcgcgaat tgggctttta tcttgaagta attccaaaaa tacaatttgg caagacaaat       480
     atttcttcga cgcttatacg taaattttta tctctgggtc aagcgggcaa tgcgtcaagc       540
     tgccttggca ggaaccatgt ttgtacgggg acagttgtgc acggcaaaaa gcgtggtcgc       600
     gaattgggat ttcctactgc taatttaggc aaggacgtct cgggctttat tccggccgat       660
     ggggtgtata tcggcagaat aatttctgac cgatcctatc ccgcagcggt ttcaataggc       720
     cgaaatccaa ccttcggtga tttggaattt tcgcaaatag aggcccatgc gctttatgag       780
     gatatttcct cacttgatct gtatggcagg cggattgacg ttgagttcat cgcgcacttg       840
     cgagatacca tgttgtataa atctattgac tcgttaaagg cagccattcg ctctgatgtt       900
     gagcggtgta aagagtattt ttccacaacc gtgggttga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page