(data stored in ACNUC30630 zone)

EMBL: BX251410.RNC

BX251410.RNC         Location/Qualifiers
FT   CDS_pept        237204..237851
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="TW199"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="Similar to Escherichia coli ribonuclease III Rnc or
FT                   b2567 or z3848 or ecs3433 SWALL:RNC_ECOLI (SWALL:P05797)
FT                   (226 aa) fasta scores: E(): 3e-18, 35% id in 220 aa, and to
FT                   Streptomyces coelicolor ribonuclease III Rnc or SCO5572 or
FT                   SC7A1.16 SWALL:RNC_STRCO (SWALL:Q9ZBQ7) (272 aa) fasta
FT                   scores: E(): 3.9e-26, 42.05% id in 214 aa"
FT                   /db_xref="GOA:Q83I82"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I82"
FT                   /protein_id="CAD66876.1"
FT                   /translation="MRKFNLTLPPGLLRTAFVHKSFSFENGACQNNERLEFLGDAVLGL
FT                   VVSHYLFETCPEYTEGQLSAARSYIVSGTSIAQIAKELNLGQFMLLGKGEKLAGGMDKT
FT                   SLLADLLESLIGAVMVDQGFESARDFVLALVGEKLRQVGEFSVDDPKTKLQKLTRTQLV
FT                   YEVVTEGPPHSRTFKASVIVNEKRFFGQGSSKKQAQVAAAMSALASLENKSS"
     ttgcggaagt tcaatctaac acttcctcct gggttgcttc gtacggcgtt tgtccacaag        60
     tccttttctt ttgagaacgg cgcgtgtcag aataacgagc gtcttgagtt tcttggagat       120
     gctgttcttg gccttgttgt atcgcattac ctatttgaga cctgtcctga atacactgag       180
     ggccaattat ctgccgctcg ctcatatatt gtttccggca catccattgc acaaatcgcc       240
     aaagagttaa atcttggtca gtttatgttg cttgggaaag gggaaaaact tgccggtggt       300
     atggataaaa catctctttt ggctgatttg cttgaaagtc ttattggggc tgttatggtt       360
     gatcaggggt tcgagagtgc cagagatttt gtattagccc ttgttggaga aaagctaaga       420
     caagtaggtg agttttctgt cgacgatcca aagacgaaac tgcagaagct tacccgaaca       480
     cagttggtgt acgaggttgt taccgagggc ccgccgcaca gtcgtacatt caaggcaagc       540
     gttattgtga atgaaaagag atttttcggg caagggtcaa gcaaaaaaca ggctcaagtt       600
     gcggctgcaa tgtctgcact tgcatctctg gagaacaaaa gttcatag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page