(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLB

BX251410.RPLB        Location/Qualifiers
FT   CDS_pept        245758..246591
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="TW210"
FT                   /product="50s ribosomal protein l2"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein l2
FT                   RplB or b3317 or z4688 or ecs4182 SWALL:RL2_ECOLI
FT                   (SWALL:P02387) (272 aa) fasta scores: E(): 6e-60, 56.93% id
FT                   in 274 aa"
FT                   /db_xref="GOA:Q83I75"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I75"
FT                   /protein_id="CAD66887.1"
FT                   /translation="MAVRKSNPLTPARRGMSFSDFAEITRATPHKSLLSKLSKTGGRNN
FT                   HGRITARHIGGGHKRRYRLVDFRRSDKDGVKAKVAHIEYDPNRTARIALLHFLDGAKRY
FT                   ILAPSGLKQGDVVESGSSADIRPGNSLCIRDIPVGTILHAVELRPGQGAKLARSAGSSV
FT                   RLSAKDGDFAILKLPSGEIRMVSLSCRATIGEVGNGQRLNVSLGKAGRSRWCGVRPSVR
FT                   GVAMNPVDHPHGGGEGKTSGGRHPVSPWGRPEGKTRRANKPSDRFIIRRKSRKRR"
     atggctgtta ggaagagtaa tccgctgacc cccgcacggc gtggtatgtc tttttcagac        60
     ttcgccgaaa taacgcgcgc tacgcctcac aagtcccttt tatcgaagct gtcaaaaacc       120
     ggtggtcgga ataatcatgg taggatcact gcgcgtcata tcggtggcgg gcataagcgt       180
     cgttacagac tggtagattt tcgccggtca gataaagatg gcgtaaaggc caaggtggct       240
     catatagagt atgacccgaa tcgtaccgcc agaattgccc ttttgcattt ccttgatggg       300
     gcaaagcgtt acatcttggc gccatctggc ctgaagcagg gtgatgttgt tgaatctggc       360
     agttcggctg atattaggcc tggtaacagt ctatgcatca gggatattcc ggttggtact       420
     attttgcatg ctgttgagct gcgaccgggc cagggtgcga agttggcccg gtcggccggc       480
     agttcggtcc gcttatcagc gaaggatggc gattttgcga tccttaaact gccaagtgga       540
     gagattagga tggttagcct gtcctgcagg gcaaccattg gtgaggttgg caacggacag       600
     cgtcttaatg taagcttggg gaaggctggt cgcagcaggt ggtgtggcgt tagaccttcg       660
     gttcgcggtg ttgcgatgaa tccagttgat catccacatg gcggcggtga gggaaaaact       720
     tctggcggtc ggcatccggt tagtccttgg ggtagacccg aaggtaaaac ccgcagagcc       780
     aataagccga gcgatcgttt tattattcgt cgtaaatcca ggaagcgtag gtaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page