(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLC

BX251410.RPLC        Location/Qualifiers
FT   CDS_pept        244074..244706
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="TW207"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein L3
FT                   RplC or b3320 or z4691 or ecs4185 SWALL:RL3_ECOLI
FT                   (SWALL:P02386) (209 aa) fasta scores: E(): 2.1e-32, 49.26%
FT                   id in 205 aa"
FT                   /db_xref="GOA:Q83I78"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I78"
FT                   /protein_id="CAD66884.1"
FT                   /translation="MARALLGTKVGMTQIWSGRRVVPVTAVAVTTNVVSQVKAPEKDGY
FT                   SRLQIATGAIDPRRVNRPRKGHFAKAGLTPRRFIREVDSEGSLGDEFGPEIFQEGQLVD
FT                   VVGKSKGKGFSGTMKRHNFQGVSATHGSHRNHRKPGSVGASSTPSRVFKGTRMAGRLGS
FT                   SRVTVHNLRLVKIDSENGLLLVEGAVPGSSGSPVIIRDAVKGVPIVS"
     atggcgaggg ctcttttggg tactaaggtc gggatgactc agatttggag tggtcgcagg        60
     gttgttccgg ttactgccgt cgcggttacc actaatgttg tgtctcaggt gaaggcccca       120
     gagaaggatg gttattctcg ccttcagatt gctaccggcg caatcgatcc gcgtcgcgta       180
     aacagaccga gaaagggtca ttttgctaag gcaggtctta ccccacggcg gtttatcaga       240
     gaggttgact cagagggatc gcttggagat gagttcgggc ctgagatttt tcaagaaggg       300
     cagcttgttg atgttgtcgg aaaaagtaag ggtaagggtt tttccggcac gatgaagcgg       360
     cataattttc agggcgtgtc tgcaacacac ggctcgcatc gcaatcatcg taagcccggg       420
     tcagtcggtg cttcttcaac ccccagcagg gtctttaaag gtaccaggat ggccgggcgc       480
     cttggctcaa gcagagtgac ggtgcataat ttgcgtcttg tgaaaattga ttcagaaaat       540
     gggcttttgc ttgttgaagg tgctgttcca ggatcgtccg gctcacctgt tattatccgt       600
     gacgctgtaa agggcgtgcc aattgtctcc tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page