(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLD

BX251410.RPLD        Location/Qualifiers
FT   CDS_pept        244696..245442
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="TW208"
FT                   /product="50s ribosomal protein L4"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L4 RplD SWALL:RL4_BACST (SWALL:P28601) (207 aa)
FT                   fasta scores: E(): 6.1e-28, 41.62% id in 197 aa"
FT                   /db_xref="GOA:Q83I77"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I77"
FT                   /protein_id="CAD66885.1"
FT                   /translation="MSPSATVFDIGGNAVGTLQLVGHLFDSDPNLHLIHQVVVAQQAAF
FT                   RQGTHKTKSRAEVSGSGRKPFRQKGTGNARCGSTRAPQMRGGGVVHGPVPRSYVHRTPK
FT                   KMIKAALAGCLTNRARAGRVHIVDSFGDTPSVADALTLFQITGLSSKLLVVAQASDSVA
FT                   YRSVRNIPGVRLVHVGQLNSYDVLRSDDVLFTRGAYNVFVGPSGDLAFSEDRDNPGTSL
FT                   PKSPTPEDSSDATKARSSRHDDRTGA"
     ttgtctccta gcgcgaccgt atttgatata ggtgggaatg cggtaggtac attgcagctt        60
     gtcgggcatc ttttcgactc tgatccaaac ctgcatctga tacaccaggt cgtcgttgcg       120
     cagcaagccg cattcaggca aggtacgcac aaaacaaagt ctcgggctga ggtgtccgga       180
     tcggggcgta agccgtttag gcagaagggg actggcaatg ccaggtgcgg gtcaacccgt       240
     gcaccgcaga tgcgtggtgg tggtgtcgta catggcccgg ttccacgcag ttatgttcac       300
     agaaccccaa agaaaatgat aaaggctgcg ctggctggtt gtctcaccaa tagggcgcgt       360
     gcggggagag tgcatattgt tgattccttt ggtgataccc cctctgttgc tgatgcgctt       420
     actctgtttc agataaccgg attgtcaagc aaactgcttg tagttgcaca ggctagtgat       480
     tcagttgcct acaggagtgt ccgtaatatt ccaggtgtgc gtctggtgca cgttggtcaa       540
     ctcaattcgt atgatgtctt gagaagtgac gatgtccttt ttacgagagg ggcatataac       600
     gtttttgttg gcccgtctgg agatttagca ttttctgaag accgcgacaa tcccggtaca       660
     tcacttccca aatctcccac cccggaagat agctccgatg ccacaaaagc tcgttcgtcc       720
     cgtcatgatg ataggactgg ggcatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page