(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLE

BX251410.RPLE        Location/Qualifiers
FT   CDS_pept        249622..250173
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="TW219"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein L5
FT                   RplE or b3308 or z4678 or ecs4173 SWALL:RL5_ECOLI
FT                   (SWALL:P02389) (178 aa) fasta scores: E(): 1.3e-37, 54.23%
FT                   id in 177 aa"
FT                   /db_xref="GOA:Q83I66"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I66"
FT                   /protein_id="CAD66896.1"
FT                   /translation="MTCYTPRLLTRYREEIVPVLMSRFDINNVHQVPSITKIVVNSGVG
FT                   DAARDSKIIEGAVSDITLITGQKPRINRAKQSIAKFKLREGQAVGVTATLRGRRMWEFL
FT                   DRLLTLALPRIRDFRGISDKQFDGHGNYTFGLSEQGIFHEIDQDKIDRVRGMDITVVTT
FT                   SSSDDMARALLGELGFPFKK"
     gtgacctgct acactccaag acttcttacg cggtacagag aggaaattgt tcctgtgctg        60
     atgagtcggt ttgatattaa caacgtgcat caggtgccga gtatcaccaa gattgttgtg       120
     aattctgggg tgggtgatgc tgctcgtgac tcgaagataa ttgagggagc cgtttcggat       180
     ataacactta taacggggca gaaaccgagg atcaataggg caaaacagtc gatagcgaag       240
     tttaaattgc gtgaaggtca ggcagtcgga gtaaccgcca cgctccgcgg tagaagaatg       300
     tgggaattct tagacaggtt gttgactctt gctctgccaa ggattagaga tttcaggggc       360
     atttctgaca agcagttcga tggtcacggt aattacacct tcggactcag cgagcagggc       420
     atctttcatg aaattgacca agataaaatt gatcgggtca ggggtatgga tattacagtt       480
     gtcacgacat cgtcgagtga tgatatggct cgtgcattgc ttggtgagtt gggctttccg       540
     tttaagaagt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page