(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLF

BX251410.RPLF        Location/Qualifiers
FT   CDS_pept        250595..251140
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="TW221"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L6 RplF SWALL:RL6_BACST (SWALL:P02391) (177 aa)
FT                   fasta scores: E(): 1.3e-31, 54.8% id in 177 aa"
FT                   /db_xref="GOA:Q83I64"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I64"
FT                   /protein_id="CAD66898.1"
FT                   /translation="MVDMSRVGKLPIEIPVGVEVCVNGRTVSITGPKGSLYLDIAEQIG
FT                   VSVSDGKVLVSRSDDSRTARALHGLTRALIANNVHGVLHGYTKTLEIVGTGYRVSKKGE
FT                   NLELALGFSHPVFVDPVPGVSFGVEGNSKIIVSGIDKQAVGEAAASIRKLSKPEPYKGK
FT                   GIRYSDEIVRRKVGKAGK"
     gtggtagata tgtcgcgggt tggaaaattg cctatagaga tcccagtggg ggtcgaggta        60
     tgtgttaacg gtcgaactgt gagtattacc ggcccaaagg gcagtttata ccttgatatt       120
     gctgagcaga ttggtgtctc tgtgagtgac ggtaaggttc ttgtttctag atctgacgat       180
     agccgaacag cccgtgccct gcatgggctt accagagcgc taatagctaa taatgtgcat       240
     ggtgtcctac atggctatac caaaactcta gagatagttg gcaccggata tagggtctct       300
     aagaagggtg agaatcttga gcttgcccta ggtttctctc acccggtttt tgtcgatcca       360
     gtaccgggtg tttcgtttgg tgttgagggt aatagtaaga taattgtctc cggaatagac       420
     aagcaggctg ttggtgaagc tgcagcaagt atacggaaat tgtctaagcc cgagccgtac       480
     aaaggtaagg gtatacgtta ttcagatgag attgtccgtc gtaaggttgg taaggctggt       540
     aaatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page