(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLI

BX251410.RPLI        Location/Qualifiers
FT   CDS_pept        complement(124733..125194)
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="TW114"
FT                   /product="50s ribosomal protein L9"
FT                   /note="Similar to Streptomyces coelicolor 50s ribosomal
FT                   protein L9 RplI or SCO3909 or SCH24.31 SWALL:RL9_STRCO
FT                   (SWALL:Q9X8U5) (148 aa) fasta scores: E(): 3.6e-21, 44.66%
FT                   id in 150 aa, and to Escherichia coli and Escherichia coli
FT                   O157:H7 50s ribosomal protein l9 RplI or b4203 or z5812 or
FT                   ecs5179 SWALL:RL9_ECOLI (SWALL:P02418) (149 aa) fasta
FT                   scores: E(): 1.6e-11, 39.73% id in 151 aa"
FT                   /db_xref="GOA:Q83IC2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC2"
FT                   /protein_id="CAD66797.1"
FT                   /translation="MTRVILVQDVNGLGSVGDVVEVKAGYSRNYLVPKGMAVRWTEGAQ
FT                   KHIGDISAARRAREAAALQEARDIANTLTKEAVTRELRLAANAGEDGRLFGSVTAANIA
FT                   KVLSSASGHKIDRGKIEIDSPIKTLGEHTVKVKLHPNVKVDINVVVYAE"
     atgacgagag tgattctcgt gcaggatgtc aacggtcttg ggtccgttgg tgatgttgtt        60
     gaggtaaagg ctggttacag cagaaactat cttgtgccaa agggaatggc cgttaggtgg       120
     acggagggcg cgcagaaaca tattggagac atctctgctg caagaagagc gcgcgaggcc       180
     gctgctctac aagaggcacg cgatattgca aataccctga caaaagaggc tgtaacaaga       240
     gagttaaggc ttgccgcaaa tgccggagag gatggccggt tgtttgggtc tgttactgcg       300
     gcgaatatag cgaaagtttt gtctagtgca agtggtcata aaattgacag ggggaagatt       360
     gaaattgatt cacccataaa aactctgggt gaacacaccg tcaaggtgaa gcttcacccg       420
     aatgttaagg ttgatataaa tgttgttgtt tatgccgagt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page