(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLM

BX251410.RPLM        Location/Qualifiers
FT   CDS_pept        178288..178713
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="TW153"
FT                   /product="50S ribosomal protein L13"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   L13 RplM or b3231 or z4589 or ecs4104 or stm3345 or sty3525
FT                   SWALL:RL13_ECOLI (SWALL:P02410) (142 aa) fasta scores: E():
FT                   3.8e-25, 54.33% id in 127 aa, and to Streptomyces
FT                   coelicolor 50s ribosomal protein L13 RplM or SCO4734 or
FT                   SC6G4.12 SWALL:RL13_STRCO (SWALL:Q53874) (147 aa) fasta
FT                   scores: E(): 3e-29, 52.94% id in 136 aa. N-terminus
FT                   truncated relative to homologues."
FT                   /protein_id="CAD66833.1"
FT                   /translation="MSSKQWVLVDAKDMVLGRLATQVAVLLRGKHRPTYEPHLDTGDCV
FT                   IVVNAALIRVTSNKHAKKVFYTHSGYPGGLKKRGFSDVFQKSPERVLEKAVKGMLPKNK
FT                   LGRSVFRNLRVYPGQDHPHAAQKPSVYAPTRVAQVLV"
     atgtcttcta agcagtgggt tttggttgac gccaaggata tggttttggg ccgtcttgcc        60
     acccaggttg cagttttgct gcggggcaaa cacaggccca cttacgagcc tcatcttgac       120
     acaggtgact gtgtcattgt agtgaatgcc gctcttatcc gcgtgacttc gaataagcat       180
     gctaaaaaag ttttctacac tcactccggg tatccgggtg gactgaaaaa acgtggcttt       240
     tctgatgtat ttcaaaaaag cccggagagg gttctggaaa aagctgttaa ggggatgttg       300
     ccaaaaaaca aacttggcag atcggttttt cgcaacctcc gggtctatcc cgggcaggat       360
     catccgcatg ccgcgcagaa gccatctgtc tatgcaccta ctagggttgc gcaggtgctc       420
     gtctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page