(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLN

BX251410.RPLN        Location/Qualifiers
FT   CDS_pept        248910..249281
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="TW217"
FT                   /product="50s ribosomal protein L14"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L14 RplN SWALL:RL14_BACST (SWALL:P04450) (122 aa)
FT                   fasta scores: E(): 1e-30, 72.35% id in 123 aa"
FT                   /db_xref="GOA:Q83I68"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I68"
FT                   /protein_id="CAD66894.1"
FT                   /translation="MIQQESRLKVADNTGAKSLSVIRVLGGSNRRFGSLGDVVVASVKD
FT                   AVPGSSAVKKGDVVKAVIVRSTKEVRRTDGSYIRFDDNAAVILRPDNDPRGTRIFGPVA
FT                   RELRDRKFTRIISLAPEVV"
     ttgatacaac aggagtctcg gcttaaggtc gcagataaca caggtgccaa gagtttgtcg        60
     gttatacgtg tgcttggtgg gtcgaataga cggttcggat cattgggtga tgttgtggtt       120
     gcgagcgtga aggatgcggt cccgggcagt tcggccgtta aaaagggtga tgttgtcaag       180
     gctgtaattg tccgctctac taaagaggtt aggcgtacgg acgggtcata tatcagattt       240
     gatgataatg cggctgttat tctgcggcct gacaatgatc ccagggggac tcgcatattc       300
     ggtccggttg ctcgtgaact tcgtgatcgt aagtttacga ggataatttc ccttgcccca       360
     gaggtggtct ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page